ALKAL1 Protein, Human (His, B2M)
Based on 1 Customer Validation
ALKAL1 Protein, Human (His, B2M) is a potent activating ligand for human ALK that binds to the extracellular domain of ALK.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
ALKAL1 Protein, Human (His, B2M) is a potent activating ligand for human ALK that binds to the extracellular domain of ALK.
Background
ALK and LTK ligand 1 (ALKAL1) also named “augmentor-β” or “FAM150A” is identified as a potent activating ligand for human ALK that bind to the extracellular domain of ALK. ALKAL1 is upregulated in colorectal cancer tissues and cell lines. Upregulation of ALKAL1 correlated with tumor malignancy and poor prognosis in colorectal cancer. ALKAL1 silencing inhibited tumorigenesis, metastasis and invasion of colorectal cancer cells, and inhibits SHH signaling pathway, which is essential for ALKAL1 induced migration. These findings reveal a new mechanism by which ALKAL1 participates in colorectal cancer migration and invasion via activating the SHH signaling pathway[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-B2M
-
Accession
Q6UXT8 (R28-T129)
-
Molecular Construction
-
N-term
-
6*His-B2M
-
ALKAL1 (R28-T129)
Accession # Q6UXT8 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ALKAL1; AUG-Beta; Prev. FAM150A; Augmentor-Alpha; UNQ9433; Protein FAM150A; AUGB; Augmentor-Beta; Family With Sequence Similarity 150 Member A; RPLK9433; Augmentor Beta; AUGA; ALK And LTK Ligand 1; Family With Sequence Similarity 150, Member A
-
AA Sequence
RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
-
Predicted Molecular Mass
25.5 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. V Van Deuren, et al. Structural determinants of nucleobase modification recognition in the AlkB family of dioxygenases. DNA Repair (Amst). 2020 Dec;96:102995. [Content Brief]
[2]. B J Chen, et al. The Escherichia coli AlkB protein protects human cells against alkylation-induced toxicity. J Bacteriol. 1994 Oct;176(20):6255-61. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
