Alkaline Phosphatase/ALPI Protein, Mouse (HEK293, His)
The alkaline phosphatase/ALPI protein is critical for phosphatase, metal ion binding, and homodimerization activities, affecting BMP stimulation responses. It is strategically located outside the plasma membrane and its predicted activity emphasizes cellular function. Alkaline Phosphatase/ALPI Protein, Mouse (HEK293, His) is the recombinant mouse-derived Alkaline Phosphatase/ALPI protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The alkaline phosphatase/ALPI protein is critical for phosphatase, metal ion binding, and homodimerization activities, affecting BMP stimulation responses. It is strategically located outside the plasma membrane and its predicted activity emphasizes cellular function. Alkaline Phosphatase/ALPI Protein, Mouse (HEK293, His) is the recombinant mouse-derived Alkaline Phosphatase/ALPI protein, expressed by HEK293 , with C-His labeled tag.
Background
Alkaline Phosphatase/ALPI Protein is predicted to play several vital roles, including alkaline phosphatase activity, metal ion binding activity, and protein homodimerization activity. It functions upstream of or within the cellular response to BMP stimulus, suggesting its involvement in critical signaling pathways. The protein is predicted to be strategically located in the external side of the plasma membrane, indicating its role in extracellular processes. Its predicted activity in the plasma membrane further emphasizes its significance in cellular functions. This protein is expressed prominently in the intestine and testis, and the biased expression profile in duodenum adult (RPKM 2234.3), small intestine adult (RPKM 1574.5), and one other tissue underscores its specific roles in these physiological contexts. The human ortholog(s) of this gene have been implicated in inflammatory bowel disease, further highlighting its clinical relevance. Alkaline Phosphatase/ALPL is evolutionarily conserved, with orthologous counterparts such as ALPI (alkaline phosphatase, intestinal) in several human genes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
F8VPQ6/NP_001074551.1 (I21-G501)
-
Molecular Construction
-
N-term
-
ALPI (I21-G501)
Accession # F8VPQ6/NP_001074551.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
ALPI; Intestinal-Type Alkaline Phosphatase; Alkaline Phosphatase, Intestinal; Alkaline Phosphomonoesterase; IAP; Glycerophosphatase; Intestinal Alkaline Phosphatase; Kasahara Isozyme
-
AA Sequence
IIPAEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPAVTHLMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAPLKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAG
-
Predicted Molecular Mass
53.1 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
