Alkaline Phosphatase/ALPI Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with C-His labeled tag.

Background

ALPI protein serves as an alkaline phosphatase with the capacity to hydrolyze various phosphate compounds.

Verified Bioactivity

Measured by its ability to cleave the fluorogenic peptide substrate, 4-Methylumbelliferyl phosphat. The specific activity is >10000 pmol/min/µg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Enzymatic Activity Assay

    Bioactivity - Enzymatic Activity Assay

    Measured by its ability to cleave the fluorogenic peptide substrate, 4-Methylumbelliferyl phosphat. The specific activity is 158755.391 pmol/min/µg, as measured under the described conditions.

Assay Procedure

Materials
Assay buffer: 50 mM Tris, 1 mM MgCl2, pH 9.0
Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) (HY-P72822)
Substrate: 4-Methylumbelliferyl phosphate, dissolved in deionized water to 10 mM
Standard: 4-Methumbelliferone

Procedure
1. Standard Curve: Dilute 4-Methylumbelliferone in assay buffer to concentrations of 0, 6.25, 12.5, 25, 50, 100 μmol/L. Add 100 μL of each concentration to the wells of a black microplate. Read the fluorescence with excitation and emission wavelengths of 365 nm and 445 nm (top read). Plot the measured RFU on the y-axis and the concentration of the standard (μmol/L) on the x-axis to create the standard curve and obtain the standard curve equation.
2. Dilute Human ALPI to 0.1 μg/mL in assay buffer.
3. Dilute the substrate to 50 μM in assay buffer.
4. Experimental group: Add 50 μL of 0.1 μg/mL ALPI to the wells and initiate the reaction by adding 50 μL of 50 μM substrate.
Control group: Add 50 μL of assay buffer and 50 μL of 50 μM substrate.
5. Read the fluorescence in kinetic mode for 5 minutes with excitation and emission wavelengths of 365 nm and 445 nm, respectively.
6. Calculate specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Substrate Blank
**Derived using calibration standard

Per Well:
Human ALPI: 0.005 μg
Substrate: 25 μM

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ALPI (V20-D503)
      Accession # P09923
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    ALPI; Intestinal-Type Alkaline Phosphatase; Alkaline Phosphatase, Intestinal; Alkaline Phosphomonoesterase; IAP; Glycerophosphatase; Intestinal Alkaline Phosphatase; Kasahara Isozyme

  • AA Sequence

    VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD

  • Molecular Weight

    Approximately 66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00