Alkaline Phosphatase/ALPI Protein, Human (HEK293, His)
Based on 1 Customer Validation
ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with C-His labeled tag.
Background
ALPI protein serves as an alkaline phosphatase with the capacity to hydrolyze various phosphate compounds.
Verified Bioactivity
Measured by its ability to cleave the fluorogenic peptide substrate, 4-Methylumbelliferyl phosphat. The specific activity is >10000 pmol/min/µg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Enzymatic Activity Assay
Bioactivity - Enzymatic Activity Assay
Assay Procedure
Materials
Assay buffer: 50 mM Tris, 1 mM MgCl2, pH 9.0
Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) (HY-P72822)
Substrate: 4-Methylumbelliferyl phosphate, dissolved in deionized water to 10 mM
Standard: 4-Methumbelliferone
Procedure
1. Standard Curve: Dilute 4-Methylumbelliferone in assay buffer to concentrations of 0, 6.25, 12.5, 25, 50, 100 μmol/L. Add 100 μL of each concentration to the wells of a black microplate. Read the fluorescence with excitation and emission wavelengths of 365 nm and 445 nm (top read). Plot the measured RFU on the y-axis and the concentration of the standard (μmol/L) on the x-axis to create the standard curve and obtain the standard curve equation.
2. Dilute Human ALPI to 0.1 μg/mL in assay buffer.
3. Dilute the substrate to 50 μM in assay buffer.
4. Experimental group: Add 50 μL of 0.1 μg/mL ALPI to the wells and initiate the reaction by adding 50 μL of 50 μM substrate.
Control group: Add 50 μL of assay buffer and 50 μL of 50 μM substrate.
5. Read the fluorescence in kinetic mode for 5 minutes with excitation and emission wavelengths of 365 nm and 445 nm, respectively.
6. Calculate specific activity:
Specific Activity (pmol/min/μg) = | Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU) |
| amount of enzyme (μg) |
*Adjusted for Substrate Blank
**Derived using calibration standard
Per Well:
Human ALPI: 0.005 μg
Substrate: 25 μM
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P09923 (V20-D503)
-
Molecular Construction
-
N-term
-
ALPI (V20-D503)
Accession # P09923 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ALPI; Intestinal-Type Alkaline Phosphatase; Alkaline Phosphatase, Intestinal; Alkaline Phosphomonoesterase; IAP; Glycerophosphatase; Intestinal Alkaline Phosphatase; Kasahara Isozyme
-
AA Sequence
VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD
-
Molecular Weight
Approximately 66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)