AMY2A Protein, Human (HEK293, His)
Based on 1 Customer Validation
AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.
Background
AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- Enzymes with 1,4-glycosidic bonds, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases[1].
Verified Bioactivity
Measured by its ability to release maltose from starch, that incubate at 40°C for 10minutes. The specific activity is 30000-50000 pmol/min/µg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P04746 (Q16-L511)
-
Molecular Construction
-
N-term
-
AMY2A (Q16-L511)
Accession # P04746 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
AMY2A; PA; Prev. AMY2; Pancreatic Amylase Alpha 2A; 1,4-Alpha-D-Glucan Glucanohydrolase; Alpha-Amylase; Amylase Alpha 2A (Pancreatic); Glycogenase; Pancreatic Alpha-Amylase; Amylase Alpha 2A; Amylase, Alpha 2A; Pancreatic
-
AA Sequence
QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
-
Molecular Weight
Approximately 53-58 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
