Animal-Free FGF-8a Protein, Human (His)
Based on 1 Customer Validation
Animal-Free FGF-8a Protein, Human (His) is the recombinant human-derived animal-FreeFGF-8a protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Animal-Free FGF-8a Protein, Human (His) is the recombinant human-derived animal-FreeFGF-8a protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.
Background
FGF-8b plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation, and cell migration. It is required for normal brain, eye, ear, and limb development during embryogenesis. Additionally, FGF-8b is essential for the normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (by similar: PubMed:16384934, PubMed:16597617, PubMed:8663044). It also functions in neurite outgrowth in hippocampal cells (by similar: PubMed:21576111).
Verified Bioactivity
Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <2 μg/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P55075-2 (Q23-R204)
-
Molecular Construction
-
N-term
-
FGF-8a (Q23-R204)
Accession # P55075-2 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
FGF8; HBGF-8; Fibroblast Growth Factor 8; FGF-8; AIGF; Fibroblast Growth Factor; Androgen-Induced Growth Factor; KAL6; Fibroblast Growth Factor 8 (Androgen-Induced); HH6; Heparin-Binding Growth Factor 8; FGF
-
AA Sequence
QHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
-
Predicted Molecular Mass
22.1 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
