Animal-Free Galectin-10 Protein, Human (His)
Based on 1 Customer Validation
Galectin-10 Protein, pivotal in immune regulation, recognizes cell-surface glycans, inducing anergy and suppressing CD25-positive regulatory T-cells (Treg). Interacting with CEL, it modulates immune responses, highlighting its significance in orchestrating immunoregulatory cellular processes. Animal-Free Galectin-10 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Galectin-10 Protein, pivotal in immune regulation, recognizes cell-surface glycans, inducing anergy and suppressing CD25-positive regulatory T-cells (Treg). Interacting with CEL, it modulates immune responses, highlighting its significance in orchestrating immunoregulatory cellular processes. Animal-Free Galectin-10 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Background
The Galectin-10 protein plays a pivotal role in immune regulation by recognizing cell-surface glycans. It is indispensable for the induction of anergy and the suppressive function of CD25-positive regulatory T-cells (Treg). Through its interactions with CEL, Galectin-10 contributes to the modulation of immune responses, highlighting its significance in orchestrating cellular processes involved in immunoregulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q05315 (S2-R142)
-
Molecular Construction
-
N-term
-
6*His
-
Galectin-10 (S2-R142)
Accession # Q05315 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CLC; Lectin, Galactoside-Binding, Soluble, 10; Charcot-Leyden Crystal Galectin; Galectin-10; LGALS10; MGC149659; Gal-10; LGALS10A; Charcot-Leyden Crystal Protein; Galectin 10; Eosinophil Lysophospholipase; LPPL_HUMAN; Lysolecithin Acylhydrolase; GAL10
-
AA Sequence
SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
-
Predicted Molecular Mass
16.3 kDa
-
Molecular Weight
Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
