Animal-Free IFN-lambda 3/IL-28B Protein, Human (His)

The IFN-lambda 3/IL-28B protein is a multifaceted cytokine with antiviral, antitumor, and immunomodulatory activities that plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 3/IL-28B Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

IFN-lambda 3/IL-28B Protein, a multifaceted cytokine, exhibits antiviral, antitumor, and immunomodulatory activities, playing a pivotal role in antiviral host defense, particularly within epithelial tissues. Serving as a ligand for the heterodimeric class II cytokine receptor consisting of IL10RB and IFNLR1, its engagement initiates the JAK/STAT signaling pathway, leading to the expression of IFN-stimulated genes (ISG) that establish the antiviral state. Notably, its receptor distribution is constrained, primarily exerting effects in epithelial cells due to the cell type-specific expression of the receptor IFNLR1. While not considered essential for early virus-activated host defense in vaginal infection, it proves crucial in Toll-like receptor (TLR)-induced antiviral defense and significantly contributes to the antiviral immune defense in the intestinal epithelium. Additionally, IFN-lambda 3/IL-28B exerts an immunomodulatory effect by up-regulating MHC class I antigen expression, enhancing its impact on immune responses.

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <5 ng/mL.

Human

E. coli

C-6*His

Q8IZI9 (V22-V196)

282617  [NCBI]

Full Length of Mature Protein

VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

<0.01 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.