Animal-Free IFN-lambda 3/IL-28B Protein, Human (His)
Based on 1 Customer Validation
The IFN-lambda 3/IL-28B protein is a multifaceted cytokine with antiviral, antitumor, and immunomodulatory activities that plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 3/IL-28B Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IFN-lambda 3/IL-28B protein is a multifaceted cytokine with antiviral, antitumor, and immunomodulatory activities that plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 3/IL-28B Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Background
IFN-lambda 3/IL-28B Protein, a multifaceted cytokine, exhibits antiviral, antitumor, and immunomodulatory activities, playing a pivotal role in antiviral host defense, particularly within epithelial tissues. Serving as a ligand for the heterodimeric class II cytokine receptor consisting of IL10RB and IFNLR1, its engagement initiates the JAK/STAT signaling pathway, leading to the expression of IFN-stimulated genes (ISG) that establish the antiviral state. Notably, its receptor distribution is constrained, primarily exerting effects in epithelial cells due to the cell type-specific expression of the receptor IFNLR1. While not considered essential for early virus-activated host defense in vaginal infection, it proves crucial in Toll-like receptor (TLR)-induced antiviral defense and significantly contributes to the antiviral immune defense in the intestinal epithelium. Additionally, IFN-lambda 3/IL-28B exerts an immunomodulatory effect by up-regulating MHC class I antigen expression, enhancing its impact on immune responses.
Verified Bioactivity
Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q8IZI9 (V22-V196)
-
Molecular Construction
-
N-term
-
IFN-λ3 (V22-V196)
Accession # Q8IZI9 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNL3; Interleukin-28C; Prev. IL28B; IL-28C; IL-28B; Interferon, Lambda 4; IL28C; Interleukin 28B; Interleukin 28B (Interferon, Lambda 3); Interferon 1IA1; Interferon Lambda-3; IFN-Lambda-4; Cytokine Zcyto22; ZCYTO22; Interleukin-28B; Interferon Lambda 3;
-
AA Sequence
VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
-
Predicted Molecular Mass
25.6 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
<0.01 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
