Animal-Free IFN-lambda 3/IL-28B Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The IFN-lambda 3/IL-28B protein is a multifaceted cytokine with antiviral, antitumor, and immunomodulatory activities that plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 3/IL-28B Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IFN-lambda 3/IL-28B protein is a multifaceted cytokine with antiviral, antitumor, and immunomodulatory activities that plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 3/IL-28B Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IFN-lambda 3/IL-28B Protein, a multifaceted cytokine, exhibits antiviral, antitumor, and immunomodulatory activities, playing a pivotal role in antiviral host defense, particularly within epithelial tissues. Serving as a ligand for the heterodimeric class II cytokine receptor consisting of IL10RB and IFNLR1, its engagement initiates the JAK/STAT signaling pathway, leading to the expression of IFN-stimulated genes (ISG) that establish the antiviral state. Notably, its receptor distribution is constrained, primarily exerting effects in epithelial cells due to the cell type-specific expression of the receptor IFNLR1. While not considered essential for early virus-activated host defense in vaginal infection, it proves crucial in Toll-like receptor (TLR)-induced antiviral defense and significantly contributes to the antiviral immune defense in the intestinal epithelium. Additionally, IFN-lambda 3/IL-28B exerts an immunomodulatory effect by up-regulating MHC class I antigen expression, enhancing its impact on immune responses.

Verified Bioactivity

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IFN-λ3 (V22-V196)
      Accession # Q8IZI9
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNL3; Interleukin-28C; Prev. IL28B; IL-28C; IL-28B; Interferon, Lambda 4; IL28C; Interleukin 28B; Interleukin 28B (Interferon, Lambda 3); Interferon 1IA1; Interferon Lambda-3; IFN-Lambda-4; Cytokine Zcyto22; ZCYTO22; Interleukin-28B; Interferon Lambda 3;

  • AA Sequence

    VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

  • Predicted Molecular Mass

    25.6 kDa

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00