Animal-Free M-CSF Protein, Mouse (His)
Based on 1 Customer Validation
The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. Animal-Free M-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. Animal-Free M-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Background
M-CSF Protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a pivotal role in innate immunity and inflammatory processes. Additionally, M-CSF assumes a crucial role in the regulation of osteoclast proliferation and differentiation, influencing bone resorption, and contributing to normal bone development. Beyond its skeletal impact, M-CSF is indispensable for normal male and female fertility. The cytokine also facilitates the reorganization of the actin cytoskeleton, regulates the formation of membrane ruffles, cell adhesion, and cell migration. It further plays a role in lipoprotein clearance. M-CSF exists in multiple forms, including a homodimer with two identical 150-200 kDa proteoglycan subunits, a heterodimer with a 150-200 kDa proteoglycan subunit and a truncated 43 kDa subunit, and a homodimer with two identical 43 kDa subunits. The protein's diverse functions are mediated through its interaction with the receptor CSF1R.
Verified Bioactivity
Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <6 ng/mL.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P07141-1 (K33-P187)
-
Molecular Construction
-
N-term
-
M-CSF (K33-P187)
Accession # P07141-1 -
6*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CSF1; Macrophage Colony Stimulating Factor 1; Colony Stimulating Factor 1; Lanimostim; MCSF; MGC31930; Proteoglycan Macrophage Colony-Stimulating Factor; PG-M-CSF; Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; CSF1-HERV-LTR71B Fusion Protein; Colo
-
AA Sequence
KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
-
Predicted Molecular Mass
19 kDa
-
Molecular Weight
Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)