Animal-Free MIF Protein, Mouse (His)

The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.Animal-Free MIF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIF protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

MIF Protein, a pro-inflammatory cytokine, plays a crucial role in the innate immune response to bacterial pathogens. Its expression at inflammatory sites suggests its involvement as a mediator in regulating macrophage function during host defense. Notably, MIF counters the anti-inflammatory activity of glucocorticoids. While it exhibits phenylpyruvate tautomerase and dopachrome tautomerase activities in vitro, the physiological substrate remains unknown. The significance of its tautomerase activity and its relevance to cytokine function remain unclear.

Measured by its ability to inhibit THP-1 cells migration. The ED₅₀ for this effect is 38.51ng/mL. Corresponding to a specific activity is 2.597×10^4 U/mg.

• 
  Measured by its ability to inhibit THP-1 cells migration. The ED₅₀ for this effect is 38.51 ng/mL. Corresponding to a specific activity is 2.597×10^4 U/mg.

Mouse

E. coli

C-6*His

P34884 (M1-A115)

17319  [NCBI]

Full Length

MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.