Anionic trypsin-1 Protein, Rat (His)
Serine protease 1 is a member of the trypsin family of serine proteases.Serine protease 1 is secreted by the pancreas and cleaved to its active form in the small intestine.Anionic trypsin-1 Protein, Rat (His) is the recombinant rat-derived Anionic trypsin-1 protein, expressed by E. coli , with N-10*His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Serine protease 1 is a member of the trypsin family of serine proteases.Serine protease 1 is secreted by the pancreas and cleaved to its active form in the small intestine.Anionic trypsin-1 Protein, Rat (His) is the recombinant rat-derived Anionic trypsin-1 protein, expressed by E. coli , with N-10*His labeled tag.
Serine protease 1 is a member of the trypsin family of serine proteases. Serine protease 1 is secreted by the pancreas and cleaved to its active form in the small intestine. Serine protease 1 is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-10*His
-
Accession
P00762 (24I–246N)
-
Gene ID24691
-
Molecular Construction
-
N-term
-
10*His
-
Prss1 (24I–246N)
Accession # P00762 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRSS1; TRP1; Prev. TRY1; Anionic Trypsin-I; Cationic Trypsinogen; Protease Serine 1; Nonfunctional Trypsin 1; TCR V Beta 4.1; Protease, Serine 1; Trypsinogen A; Anionic Trypsin I; Trypsinogen 1; Pretrypsinogen I; Trypsin 1; Beta-Trypsin; Trypsin-1; Trypsi
-
AA Sequence
IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
-
Predicted Molecular Mass
27.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
