ATP5D Protein, Human (His)

Customer Review

Based on 1 Customer Validation

ATP5D Protein, a vital component of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. As part of the F(1) domain and central stalk, ATP5D contributes to ATP hydrolysis through a rotary mechanism. The ATP synthase complex, involving ATP5D, is pivotal for cellular energy production via ATP synthesis. ATP5D Protein, Human (His) is the recombinant human-derived ATP5D protein, expressed by E. coli , with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ATP5D Protein, a vital component of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. As part of the F(1) domain and central stalk, ATP5D contributes to ATP hydrolysis through a rotary mechanism. The ATP synthase complex, involving ATP5D, is pivotal for cellular energy production via ATP synthesis. ATP5D Protein, Human (His) is the recombinant human-derived ATP5D protein, expressed by E. coli , with N-10*His labeled tag.

Background

The ATP5D protein functions as a crucial component of the mitochondrial membrane ATP synthase, also known as Complex V. This enzyme is responsible for generating ATP from ADP by utilizing the proton gradient across the mitochondrial membrane, a gradient established by the electron transport complexes of the respiratory chain. The F-type ATPases, to which ATP5D belongs, consist of two main structural domains: F(1), housing the catalytic core, and F(0), housing the membrane proton channel. During catalysis, ATP turnover in the F(1) catalytic domain is linked to proton translocation through a rotary mechanism involving the central stalk subunits. ATP5D is part of both the F(1) domain and the central stalk, contributing to the rotation that leads to ATP hydrolysis. The ATP synthase complex, in which ATP5D participates, includes various subunits and plays a pivotal role in cellular energy production through ATP synthesis.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • ATP5D (A23-E168)
      Accession # P30049
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    ATP5F1D; F-ATPase Delta Subunit; Prev. ATP5D; ATP Synthase Subunit Delta, Mitochondrial; ATP Synthase F(1) Complex Subunit Delta, Mitochondrial; Mitochondrial ATP Synthase, Delta Subunit; ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, Delta Subu

  • AA Sequence

    AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00