1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Translocases (EC 7)
  4. ATP5D Protein, Human (His)

ATP5D Protein, a vital component of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. As part of the F(1) domain and central stalk, ATP5D contributes to ATP hydrolysis through a rotary mechanism. The ATP synthase complex, involving ATP5D, is pivotal for cellular energy production via ATP synthesis. ATP5D Protein, Human (His) is the recombinant human-derived ATP5D protein, expressed by E. coli , with N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ATP5D Protein, a vital component of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. As part of the F(1) domain and central stalk, ATP5D contributes to ATP hydrolysis through a rotary mechanism. The ATP synthase complex, involving ATP5D, is pivotal for cellular energy production via ATP synthesis. ATP5D Protein, Human (His) is the recombinant human-derived ATP5D protein, expressed by E. coli , with N-10*His labeled tag.

Background

The ATP5D protein functions as a crucial component of the mitochondrial membrane ATP synthase, also known as Complex V. This enzyme is responsible for generating ATP from ADP by utilizing the proton gradient across the mitochondrial membrane, a gradient established by the electron transport complexes of the respiratory chain. The F-type ATPases, to which ATP5D belongs, consist of two main structural domains: F(1), housing the catalytic core, and F(0), housing the membrane proton channel. During catalysis, ATP turnover in the F(1) catalytic domain is linked to proton translocation through a rotary mechanism involving the central stalk subunits. ATP5D is part of both the F(1) domain and the central stalk, contributing to the rotation that leads to ATP hydrolysis. The ATP synthase complex, in which ATP5D participates, includes various subunits and plays a pivotal role in cellular energy production through ATP synthesis.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-10*His

Accession

P30049 (A23-E168)

Gene ID

513  [NCBI]

Molecular Construction
N-term
10*His
ATP5D (A23-E168)
Accession # P30049
C-term
Protein Length

Full Length of Mature Protein

Synonyms
ATP synthase subunit delta; mitochondrial ; ATP synthase subunit delta; mitochondrial; ATP synthase; H+ transporting; mitochondrial F1 complex; delta subunit; ATP5D; ATPD_HUMAN; F ATPase delta subunit ; F-ATPase delta subunit; Mitochondrial ATP synthase complex delta subunit precusor ; Mitochondrial ATP synthase delta subunit
AA Sequence

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Molecular Weight

Approximately 20 kDa

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ATP5D Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ATP5D Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ATP5D Protein, Human (His)
Cat. No.:
HY-P72098
Quantity:
MCE Japan Authorized Agent: