B7-1/CD80 Protein, Cynomolgus (HEK293, His)

CD80 is a costimulatory cytokine for cancer immunity that is activated by binding to CD28 or CTLA-4. Tumor immune evasion occurs when CD80 expression is low. The increased expression of CD80 induced by TP53 stimulates anti-tumor immune responses. B7-1/CD80 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-6*His labeled tag.

CD80 is a membrane receptor and costimulatory cytokine used by immune cells to limit cancer progression. CD80 is activated by binding to CD28 or CTLA-4, thereby inducing T cell proliferation and cytokine production. The immune evasion mechanism of colon cancer is related to the low surface expression of CD80. When CD80 is upregulated on the surface of tumor cells, the anti-tumor immune response can be successfully activated. Normal expression levels of CD80 are frequently lost during tumor progression, possibly due to selective pressure from the immune system. TP53 is a regulator of CD80 expression in human cancer cells, and CD80 expression is strongly correlated with TP53 activation. TP53 induces antitumor immune responses through induction of CD80 in human cancer epithelial cells. CD80 serves as a receptor for adenovirus subtype B and may play a role in lupus neuropathy. CD80/CD86-conjugated adenovirus serotype 5 (Ad5)/3 chimeras improve expression and transduction efficiency with excellent transduction efficiency and low toxicity in brain tumors. Additionally, measurement of urinary CD80 excretion levels was able to differentiate between minimal change disease and focal segmental glomerulosclerosis in a mouse model of foot process effacement and human lupus nephritis.

Loaded Cynomolgus CTLA-4-Fc on Protein A Biosensor, can bind Cynomolgus B7-1-His with an affinity constant of 0.87 uM as determined in BLI assay.

Cynomolgus

HEK293

C-6*His

G7NXN7 (V35-N242)

102140078  [NCBI]

Partial

VATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDN

35-55 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Scarpa M, et al. CD80 expression is upregulated by TP53 activation in human cancer epithelial cells. Oncoimmunology. 2021 Apr 5;10(1):1907912.  [Content Brief]

  [2]. Ulasov IV, et al. Targeting adenovirus to CD80 and CD86 receptors increases gene transfer efficiency to malignant glioma cells. J Neurosurg. 2007 Sep;107(3):617-27.  [Content Brief]

  [3]. Kistler AD  [Content Brief]