B7-1/CD80 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
CD80 is a costimulatory cytokine for cancer immunity that is activated by binding to CD28 or CTLA-4. Tumor immune evasion occurs when CD80 expression is low. The increased expression of CD80 induced by TP53 stimulates anti-tumor immune responses. B7-1/CD80 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CD80 is a costimulatory cytokine for cancer immunity that is activated by binding to CD28 or CTLA-4. Tumor immune evasion occurs when CD80 expression is low. The increased expression of CD80 induced by TP53 stimulates anti-tumor immune responses. B7-1/CD80 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CD80 is a membrane receptor and costimulatory cytokine used by immune cells to limit cancer progression. CD80 is activated by binding to CD28 or CTLA-4, thereby inducing T cell proliferation and cytokine production. The immune evasion mechanism of colon cancer is related to the low surface expression of CD80. When CD80 is upregulated on the surface of tumor cells, the anti-tumor immune response can be successfully activated. Normal expression levels of CD80 are frequently lost during tumor progression, possibly due to selective pressure from the immune system. TP53 is a regulator of CD80 expression in human cancer cells, and CD80 expression is strongly correlated with TP53 activation. TP53 induces antitumor immune responses through induction of CD80 in human cancer epithelial cells. CD80 serves as a receptor for adenovirus subtype B and may play a role in lupus neuropathy. CD80/CD86-conjugated adenovirus serotype 5 (Ad5)/3 chimeras improve expression and transduction efficiency with excellent transduction efficiency and low toxicity in brain tumors. Additionally, measurement of urinary CD80 excretion levels was able to differentiate between minimal change disease and focal segmental glomerulosclerosis in a mouse model of foot process effacement and human lupus nephritis.
Verified Bioactivity
Loaded Cynomolgus CTLA-4-Fc on Protein A Biosensor, can bind Cynomolgus B7-1-His with an affinity constant of 0.87 uM as determined in BLI assay.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-6*His
-
Accession
G7NXN7 (V35-N242)
-
Molecular Construction
-
N-term
-
B7-1 (V35-N242)
Accession # G7NXN7 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD80; B-Lymphocyte Activation Antigen B7; Prev. CD28LG1; LAB7; Prev. CD28LG; BB1; T-Lymphocyte Activation Antigen CD80; B7; Activation B7-1 Antigen; Costimulatory Molecule Variant IgV-CD80; B7.1; Costimulatory Factor CD80; B7-1; CD80 Molecule; CD80 Antige
-
AA Sequence
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDN
-
Predicted Molecular Mass
24.7 kDa
-
Molecular Weight
Approximately 35-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Scarpa M, et al. CD80 expression is upregulated by TP53 activation in human cancer epithelial cells. Oncoimmunology. 2021 Apr 5;10(1):1907912. [Content Brief]
[2]. Ulasov IV, et al. Targeting adenovirus to CD80 and CD86 receptors increases gene transfer efficiency to malignant glioma cells. J Neurosurg. 2007 Sep;107(3):617-27. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
