B7-2/CD86 Protein, Human (Biotinylated, HEK293, His)
Based on 1 Customer Validation
B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived B7-2/CD86 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived B7-2/CD86 protein, expressed by HEK293 , with C-His labeled tag.
Background
B7-2/CD86 protein functions as a negative regulator of T-cell activation by disrupting the formation of CD86 clusters. Through this interference, it modulates the T-cell response and plays a role in regulating immune activation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P42081-1 (L26-H245)
-
Molecular Construction
-
N-term
-
B7-2 (L26-H245)
Accession # P42081-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Conjugate Method
The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.
-
Synonyms
CD86; FUN-1; Prev. CD28LG2; B70; T-Lymphocyte Activation Antigen CD86; B-Lymphocyte Activation Antigen B7-2; B7.2; B-Lymphocyte Antigen B7-2; B7-2; CD86 Antigen; CD86 Antigen (CD28 Antigen Ligand 2, B7-2 Antigen); CD86 V6; CTLA-4 Counter-Receptor B7.2; LA
-
AA Sequence
LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDH
-
Predicted Molecular Mass
26.2 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)