B7-H2/ICOSLG Protein, Human (HEK293, His-Avi)
B7-H2/ICOSLG Protein, a ligand for T-cell receptor ICOS, critically costimulates T-cell proliferation and cytokine secretion. It induces B-cell proliferation and supports plasma cell differentiation, playing a key role in local tissue responses to inflammation. B7-H2/ICOSLG also modulates the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, it has been observed to interact with CTLA4 in vitro. B7-H2/ICOSLG Protein, Human (HEK293, His-Avi) is the recombinant human-derived B7-H2/ICOSLG protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
B7-H2/ICOSLG Protein, a ligand for T-cell receptor ICOS, critically costimulates T-cell proliferation and cytokine secretion. It induces B-cell proliferation and supports plasma cell differentiation, playing a key role in local tissue responses to inflammation. B7-H2/ICOSLG also modulates the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, it has been observed to interact with CTLA4 in vitro. B7-H2/ICOSLG Protein, Human (HEK293, His-Avi) is the recombinant human-derived B7-H2/ICOSLG protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
B7-H2/ICOSLG protein serves as a ligand for the T-cell-specific cell surface receptor ICOS, functioning as a critical costimulatory signal for T-cell proliferation and cytokine secretion. Additionally, it induces B-cell proliferation and facilitates their differentiation into plasma cells. This protein is poised to play a significant role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, B7-H2/ICOSLG has been shown to interact with CTLA4 in vitro.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
O75144-1 (D19-S258)
-
Molecular Construction
-
N-term
-
B7-H2/ICOSLG (D19-S258)
Accession # O75144-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ICOSLG; KIAA0653; Prev. ICOSL; CD275; B7-Related Protein 1; GL50; B7 Homolog 2; B7h; B7RP-1; B7 Homologue 2; B7RP1; Transmembrane Protein B7-H2 ICOS Ligand; B7-H2; Inducible T-Cell Costimulator Ligand; B7H2; CD275 Antigen; B7-Like Protein Gl50; IMD119; IC
-
AA Sequence
DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
-
Predicted Molecular Mass
29.5 kDa
-
Molecular Weight
Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
