1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. B7-H2/ICOSLG B7-H2/CD275
  5. B7-H2/ICOSLG Protein, Human (HEK293, His-Avi)

B7-H2/ICOSLG Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P78392
Handling Instructions Technical Support

B7-H2/ICOSLG Protein, a ligand for T-cell receptor ICOS, critically costimulates T-cell proliferation and cytokine secretion. It induces B-cell proliferation and supports plasma cell differentiation, playing a key role in local tissue responses to inflammation. B7-H2/ICOSLG also modulates the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, it has been observed to interact with CTLA4 in vitro. B7-H2/ICOSLG Protein, Human (HEK293, His-Avi) is the recombinant human-derived B7-H2/ICOSLG protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

B7-H2/ICOSLG Protein, a ligand for T-cell receptor ICOS, critically costimulates T-cell proliferation and cytokine secretion. It induces B-cell proliferation and supports plasma cell differentiation, playing a key role in local tissue responses to inflammation. B7-H2/ICOSLG also modulates the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, it has been observed to interact with CTLA4 in vitro. B7-H2/ICOSLG Protein, Human (HEK293, His-Avi) is the recombinant human-derived B7-H2/ICOSLG protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

B7-H2/ICOSLG protein serves as a ligand for the T-cell-specific cell surface receptor ICOS, functioning as a critical costimulatory signal for T-cell proliferation and cytokine secretion. Additionally, it induces B-cell proliferation and facilitates their differentiation into plasma cells. This protein is poised to play a significant role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, B7-H2/ICOSLG has been shown to interact with CTLA4 in vitro.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

O75144-1 (D19-S258)

Gene ID
Molecular Construction
N-term
B7-H2/ICOSLG (D19-S258)
Accession # O75144-1
8*His-Avi
C-term
Protein Length

Extracellular Domain

Synonyms
CD275; B7H2; B7-H2; B7RP-1; GL50; ICOSL; ICOS-L; ICOSLG; B7RP1; LICOS; ICOS ligand; B7-H2B7-related protein 1; B7RP-1; B7RP1B7-like protein Gl50
AA Sequence

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS

Predicted Molecular Mass
29.5 kDa
Molecular Weight

Approximately 50-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

B7-H2/ICOSLG Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-H2/ICOSLG Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P78392
Quantity:
MCE Japan Authorized Agent: