1. Recombinant Proteins
  2. Immune Checkpoint Proteins Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules
  4. B7-H4
  5. B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi)

B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78073
Handling Instructions Technical Support

The B7-H4 protein acts as a negative regulator, inhibiting T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived B7-H4 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg Get quote
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The B7-H4 protein acts as a negative regulator, inhibiting T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived B7-H4 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

B7-H4 protein functions as a negative regulator of the T-cell-mediated immune response, exerting inhibitory effects on T-cell activation, proliferation, cytokine production, and the development of cytotoxicity. Particularly significant when expressed on the cell surface of tumor macrophages, B7-H4, in collaboration with regulatory T-cells (Treg), plays a crucial role in suppressing tumor-associated antigen-specific T-cell immunity. Additionally, B7-H4 is implicated in the promotion of epithelial cell transformation, indicating its multifaceted involvement in modulating immune responses and cellular processes associated with tumor development.

Biological Activity

1. Measured by its binding ability in a functional ELISA. When immobilized Anti-B7-H4 Antibody at 1μg/ml (100μl/well), can bind Biotinylated Human B7-H4, His Tag and the EC50 is < 65 ng/mL.
2. Loaded Puxitatug (HY-P990059) on AHC2 biosensor, can bind B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi) with an affinity constant of 4.217E-09 M as determined in BLI assay.
3. Loaded Emiltatug (HY-P990918) on AHC2 biosensor, can bind B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi) with an affinity constant of 8.115E-09 M as determined in BLI assay.

  • Loaded Puxitatug (HY-P990059) on AHC2 biosensor, can bind B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi) with an affinity constant of 4.217E-09 M as determined in BLI assay.
  • Loaded Emiltatug (HY-P990918) on AHC2 biosensor, can bind B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi) with an affinity constant of 8.115E-09 M as determined in BLI assay.
Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

Q7Z7D3-1 (F29-A258)

Gene ID
Molecular Construction
N-term
B7-H4 (F29-A258)
Accession # Q7Z7D3-1
8*His-Avi
C-term
Protein Length

Extracellular Domain

Conjugation

Biotin

Conjugate Method

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

Synonyms
B7H4; B7-H4; B7S1; B7h.5; B7x; FLJ22418; VTCN1; PRO1291
AA Sequence

FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA

Predicted Molecular Mass
28.2 kDa
Molecular Weight

Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-H4 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78073
Quantity:
MCE Japan Authorized Agent: