BAFF/TNFSF13B Protein, Mouse (Biotinylated, HEK293, His-Avi)
BAFF/TNFSF13B protein binds to TNFRSF13B and TNFRSF17, stimulating B- and T-cell function and regulating humoral immunity. It also interacts with TNFSF13, promoting the survival and response of mature B-cells. Interestingly, BAFF/TNFSF13B isoform 2 inhibits isoform 1's secretion and bioactivity. BAFF/TNFSF13B, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived BAFF/TNFSF13B protein, expressed by HEK293, with N-Avi labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BAFF/TNFSF13B protein binds to TNFRSF13B and TNFRSF17, stimulating B- and T-cell function and regulating humoral immunity. It also interacts with TNFSF13, promoting the survival and response of mature B-cells. Interestingly, BAFF/TNFSF13B isoform 2 inhibits isoform 1's secretion and bioactivity. BAFF/TNFSF13B, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived BAFF/TNFSF13B protein, expressed by HEK293, with N-Avi labeled tag.
Background
BAFF/TNFSF13B Protein is a cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA, forming a 2 ligands-2 receptors pathway that plays a crucial role in the stimulation of B- and T-cell function, as well as the regulation of humoral immunity. Additionally, BAFF/TNFSF13B interacts with TNFSF13/APRIL, which also binds to the same two receptors. The BAFF/TNFSF13B-BAFFR/BR3 interaction specifically promotes the survival of mature B-cells and enhances the overall B-cell response. Notably, isoform 2 of BAFF/TNFSF13B appears to inhibit the secretion and bioactivity of isoform 1.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-Avi;N-His
-
Accession
Q9WU72-1 (A127-L309)
-
Gene ID24099
-
Molecular Construction
-
N-term
-
His-Avi
-
BAFF (A127-L309)
Accession # Q9WU72 -
C-term
-
-
Protein Length
Full Length of TNFSF13B, soluble form
-
Conjugation
Biotin
-
Synonyms
TNFSF13B; Dendritic Cell-Derived TNF-Like Molecule; Prev. TNFSF20; Tumor Necrosis Factor Ligand 7A; TALL-1; ZTNF4; TALL1; Tumor Necrosis Factor (Ligand) Superfamily, Member 20; BAFF; TNF- And APOL-Related Leukocyte Expressed Ligand 1; BLYS; Tumor Necrosis
-
AA Sequence
AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL
-
Predicted Molecular Mass
65.8 kDa
-
Molecular Weight
Approximately 60-65 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
