BAK1 Protein, Human
Based on 1 Customer Validation
BAK1 Protein, Human is the recombinant human-derived BAK1, expressed by E. coli, with tag free labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
BAK1 Protein, Human is the recombinant human-derived BAK1, expressed by E. coli, with tag free labeled tag.
Bak is a protein that plays a critical role in the mitochondrial apoptotic process. Upon receiving cell death signals, Bak oligomerizes to form pores in the mitochondrial outer membrane (MOM), promoting MOM permeabilization. This releases apoptogenic factors, such as cytochrome c, into the cytosol, leading to the activation of caspase 9 and subsequently the effector caspases.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q16611 (A2-G186)
-
Gene ID578
-
Protein Length
Partial
-
Synonyms
BAK1; Bcl-2-Like Protein 7; Prev. CDN1; Pro-Apoptotic Protein BAK; BCL2L7; BCL2-Antagonist/Killer 1; BAK; BCL2-Like 7 Protein; Bcl-2 Homologous Antagonist/Killer; BAK-LIKE; Apoptosis Regulator BAK; BCL2 Antagonist/Killer 1; Bcl2-L-7
-
AA Sequence
ASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG
-
Predicted Molecular Mass
20.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5 or 50 mM HEPES (pH 7.5), 200 mM NaCl, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
