Basigin/CD147 Protein, Mouse (304a.a, HEK293, His)
Based on 1 Customer Validation
The Basigin/CD147 protein is essential for retinal maturation and development, acting as a NXNL1 receptor to promote the survival of retinal cone photoreceptor cells. Basigin/CD147 Protein, Mouse (304a.a, HEK293, His) is the recombinant mouse-derived Basigin/CD147 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Basigin/CD147 protein is essential for retinal maturation and development, acting as a NXNL1 receptor to promote the survival of retinal cone photoreceptor cells. Basigin/CD147 Protein, Mouse (304a.a, HEK293, His) is the recombinant mouse-derived Basigin/CD147 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Basigin/CD147 protein is indispensable for normal retinal maturation and development, acting as a crucial cell surface receptor for NXNL1 and contributing significantly to NXNL1-mediated survival of retinal cone photoreceptors. In collaboration with the glucose transporter SLC16A1/GLUT1 and NXNL1, Basigin/CD147 promotes retinal cone survival by enhancing aerobic glycolysis and facilitating the entry of glucose into photoreceptors. It serves as a signaling receptor for cyclophilins, playing an essential role in PPIA/CYPA and PPIB/CYPB-dependent signaling related to the chemotaxis and adhesion of immune cells. Additionally, Basigin/CD147 is pivotal in targeting the monocarboxylate transporters SLC16A1, SLC16A3, and SLC16A8 to the plasma membrane. Acting as a coreceptor for vascular endothelial growth factor receptor 2 (KDR/VEGFR2) in endothelial cells, it enhances VEGFA-mediated activation and downstream signaling, promoting angiogenesis through EPAS1/HIF2A-mediated up-regulation of VEGFA and KDR/VEGFR2. Moreover, Basigin/CD147 plays a crucial role in spermatogenesis, mediating interactions between germ cells and Sertoli cells and proving essential for the development and differentiation of germ cells into round spermatids.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P18572-1 (A22-R325)
-
Molecular Construction
-
N-term
-
Basigin (A22-R325)
Accession # P18572-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
BSG; Leukocyte Activation Antigen M6; Prev. OK; Hepatoma-Associated Antigen; EMMPRIN; OK Blood Group Antigen; Basigin; HAb18G; Tumor Cell-Derived Collagenase Stimulatory Factor; TCSF; Extracellular Matrix Metalloproteinase Inducer; 5F7; EMPRIN; Ok Blood G
-
AA Sequence
AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR
-
Predicted Molecular Mass
34.1 kDa
-
Molecular Weight
Approximately 40-70 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
