Copy Link Print Information

Bcl-2-like protein 2 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Bcl-2-like protein 2 is a key regulator that promotes cell survival and prevents dexamethasone-induced apoptosis, which is critical for postmitotic Sertoli cells. It inhibits BAX, emphasizing its role in survival mechanisms. Bcl-2-like protein 2 Protein, Human (His) is the recombinant human-derived Bcl-2-like protein 2 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for Bcl-2-like protein 2 Protein, Human (His)
  • Experimental Validation Results for Bcl-2-like protein 2 Protein, Human (His)
  • Bcl-2-like protein 2 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Bcl-2-like protein 2 is a key regulator that promotes cell survival and prevents dexamethasone-induced apoptosis, which is critical for postmitotic Sertoli cells. It inhibits BAX, emphasizing its role in survival mechanisms. Bcl-2-like protein 2 Protein, Human (His) is the recombinant human-derived Bcl-2-like protein 2 protein, expressed by E. coli , with C-6*His labeled tag.

Background

Bcl-2-like protein 2, a crucial player in cellular dynamics, exerts its influence by promoting cell survival and effectively blocking dexamethasone-induced apoptosis. This multifunctional protein plays a pivotal role in the survival of postmitotic Sertoli cells, where it suppresses the death-promoting activity of BAX. The intricate molecular network extends to interactions with HIF3A through its C-terminus domain, emphasizing its involvement in complex signaling pathways. Additionally, Bcl-2-like protein 2 engages in interactions with BOP, further highlighting its role in cellular homeostasis. The nuanced functions of Bcl-2-like protein 2 underscore its significance in orchestrating cell survival mechanisms and warrant further exploration to comprehensively understand its molecular contributions in diverse cellular contexts.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized BID at 5 μg/mL (100 μL/well) can bind human Bcl-2-like protein 2. The ED50 for this effect is 10.09 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized BID at 5 μg/mL (100 μL/well) can bind human Bcl-2-like protein 2. The ED50 for this effect is 10.09 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    AAI13523.1 (A2-T172)

  • Gene ID
    599  [NCBI]
  • Molecular Construction
    • N-term
    • BCL2L2 (A2-T172)
      Accession # Q92843
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    BCL2L2; Protein Phosphatase 1, Regulatory Subunit 51; BCL2 Like 2; Apoptosis Regulator Bcl-W; Bcl-2-Like Protein 2; BCLW; KIAA0271; Apoptosis Regulator BCL-W; PPP1R51; BCL2-L-2; BCL-W; Bcl2-L-2

  • AA Sequence

    ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRT

  • Molecular Weight

    Approximately 18-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 25 mM HEPES, 100 mM KCl, 20% glycerol, pH 7.5.
2.Supplied as a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Liu HN, et al. MiR-93 Inhibits Trophoblast Cell Proliferation and Promotes Cell Apoptosis by Targeting BCL2L2 in Recurrent Spontaneous Abortion. Reprod Sci. 2020;27(1):152-162. [Content Brief]

[2]. Hartman ML, et al. BCL-w: apoptotic and non-apoptotic role in health and disease. Cell Death Dis. 2020;11(4):260. Published 2020 Apr 21. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized BID at 5 μg/mL (100 μL/well) can bind human Bcl-2-like protein 2. The ED50 for this effect is 10.09 ng/mL.

  • Bcl-2-like protein 2 Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for Bcl-2-like protein 2 Protein, Human (His)
  • Experimental Validation Results for Bcl-2-like protein 2 Protein, Human (His)
  • Bcl-2-like protein 2 Protein, Human (His) Product Image