BGLAP Protein, Mouse (His-SUMO)
Based on 1 Customer Validation
The BGLAP protein, in its carboxylated state, forms an important part of the bone matrix and acts as a negative regulator of bone formation. It limits bone formation and preserves processes such as resorption and mineralization. BGLAP Protein, Mouse (His-SUMO) is the recombinant mouse-derived BGLAP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The BGLAP protein, in its carboxylated state, forms an important part of the bone matrix and acts as a negative regulator of bone formation. It limits bone formation and preserves processes such as resorption and mineralization. BGLAP Protein, Mouse (His-SUMO) is the recombinant mouse-derived BGLAP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
The BGLAP protein, in its carboxylated form, stands as a major organic constituent within the bone matrix, representing 1-2% of the total bone protein. In this carboxylated state, it serves as a negative regulator of bone formation, crucial for limiting bone formation while preserving the processes of bone resorption and mineralization. Notably, the carboxylated form exhibits strong binding affinity to apatite and calcium. Conversely, the uncarboxylated form functions as a hormone secreted by osteoblasts, exerting regulatory influence over diverse cellular processes. This includes its role in energy metabolism, where it acts as a hormone promoting pancreatic beta-cell proliferation, insulin secretion, insulin sensitivity, and energy expenditure. Moreover, the uncarboxylated osteocalcin hormone functions as a key player in male fertility by promoting testosterone production in the testes through its interaction with the G protein-coupled receptor GPRC6A. Additionally, it acts as a regulator of brain development, crossing the blood-brain barrier to initiate signaling responses that prevent neuronal apoptosis in the hippocampus, stimulate the synthesis of monoamine neurotransmitters, and inhibit gamma-aminobutyric acid (GABA) synthesis. Importantly, maternal osteocalcin, which crosses the placenta during pregnancy, plays a crucial role in fetal brain development.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P86546 (Y50-I95)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
BGLAP (Y50-I95)
Accession # P86546 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
BGLAP; BGP; Bone Gamma-Carboxyglutamate Protein; Bone Gla Protein; Gamma-Carboxyglutamic Acid-Containing Protein; Bone Gamma-Carboxyglutamate (Gla) Protein (Osteocalcin); Osteocalcin; Bone Gamma-Carboxyglutamate (Gla) Protein; OCN; OC
-
AA Sequence
YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI
-
Predicted Molecular Mass
21.1 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)