BMPG Protein, Human (HEK293, His)

BMPG Protein, Human (HEK293, His) is a recombinant human bone marrow proteoglycan produced in HEK293 cells.

For research use only. We do not sell to patients.

* Please select Quantity before adding items.

Description	BMPG Protein, Human (HEK293, His) is a recombinant human bone marrow proteoglycan produced in HEK293 cells^[1].
Background	Proteoglycans within the extracellular matrix of human bone marrow have been implicated in the process of hematopoiesis, but little is known about the structure and composition of these macromolecules in this tissue^[1].
Species	Human
Source	HEK293
Tag	C-6*His
Accession	AAH05929.1 (L17-Y222 )
Gene ID	5553 [NCBI]
Molecular Construction	N-term BMPG (L17-Y222 ) Accession # AAH05929.1 6*His C-term
Synonyms	rHuBMPG, His; Bone Marrow Proteoglycan; BMPG;
AA Sequence	LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSYHHHHHH
Molecular Weight	Approximately 33.0 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Documentation	Data Sheet (261 KB) Handling Instructions (2659 KB)
References	[1]. Wight TN, et al. Proteoglycans in human long-term bone marrow cultures: biochemical and ultrastructural analyses. Blood. 1986;67(5):1333-1343. [Content Brief]

BMPG Protein, Human (HEK293, His) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.