Copy Link Print Information

BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi)
  • BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

BTLA/CD272, an inhibitory receptor expressed on lymphocytes, serves as a negative regulator of antigen receptor signaling through interactions with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. These interactions contribute to the modulation of immune responses and the maintenance of lymphocyte homeostasis. BTLA may engage in both cis and trans interactions with TNFRSF14, with cis interactions playing a regulatory role in naive T cells, inhibiting trans interactions to maintain a resting state. In contrast, trans interactions, predominant during adaptive immune responses, provide survival signals to effector T cells. The intricate interplay between BTLA and its binding partners underscores its multifaceted role in immune regulation.

Verified Bioactivity

1. Measured by its binding ability in a functional ELISA. When immobilized Anti-BTLA Antibody,hFc Tag at 0.5μg/ml (100μl/well), can bind Biotinylaterd Human BTLA, His Tag with the EC50 of <10 ng/ml.
Loaded Zadoprubart (HY-P991038) on ProA biosensor, can bind BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi) with an affinity constant of 3.726E-09 M as determined in BLI assay.

MCE Validation Data

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Zadoprubart (HY-P991038) on ProA biosensor, can bind BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi) with an affinity constant of 3.726E-09 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession

    Q7Z6A9-1 (K31-S150)

  • Gene ID
    151888  [NCBI]
  • Molecular Construction
    • N-term
    • BTLA (K31-S150)
      Accession # Q7Z6A9-1
    • 8*His-Avi
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    BTLA; BTLA1; B And T Lymphocyte Associated; CD272; B- And T-Lymphocyte-Associated Protein; Alternative Protein BTLA; B- And T-Lymphocyte Attenuator; CD272 Antigen

  • AA Sequence

    KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS

  • Predicted Molecular Mass

    16.7 kDa

  • Molecular Weight

    Approximately 28-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Loaded Zadoprubart (HY-P991038) on ProA biosensor, can bind BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi) with an affinity constant of 3.726E-09 M as determined in BLI assay.

  • BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
    1/16
  • Experimental Validation Results for BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi)
  • BTLA/CD272 Protein, Human (Biotinylated, HEK293, His-Avi) Product Image