1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins
  4. BTLA BTLA/CD272
  5. BTLA/CD272 Protein, Rat (HEK293, mFc)

BTLA/CD272 protein inhibits antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It regulates immune responses through cis and trans interactions with TNFRSF14. In cis, it maintains resting state in naive T cells, while in trans, it supports survival signals in effector T cells. BTLA/CD272 interacts with PTPN6/SHP-1, PTPN11/SHP-2, and TNFRSF14/HVEM. BTLA/CD272 Protein, Rat (HEK293, mFc) is the recombinant rat-derived BTLA/CD272 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTLA/CD272 protein inhibits antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It regulates immune responses through cis and trans interactions with TNFRSF14. In cis, it maintains resting state in naive T cells, while in trans, it supports survival signals in effector T cells. BTLA/CD272 interacts with PTPN6/SHP-1, PTPN11/SHP-2, and TNFRSF14/HVEM. BTLA/CD272 Protein, Rat (HEK293, mFc) is the recombinant rat-derived BTLA/CD272 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

BTLA/CD272 protein serves as an inhibitory receptor on lymphocytes, exerting negative regulation on antigen receptor signaling through PTPN6/SHP-1 and PTPN11/SHP-2. It engages in both cis and trans interactions with TNFRSF14. In cis interactions, BTLA/CD272 plays an immune regulatory role, inhibiting trans interactions in naive T cells to maintain a resting state. Conversely, in trans interactions, it can predominate during adaptive immune responses, providing survival signals to effector T cells. The protein interacts with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 and also engages with TNFRSF14/HVEM through its cysteine-rich domain 1.

Biological Activity

Measured by its binding ability in a functional ELISA. When Mouse HVEM/TNFRSF14 is immobilized at 0.5 μg/mL(100 μL/well)can bind Recombinant Rat BTLA. The ED50 for this effect is approximately 1.083 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Mouse HVEM/TNFRSF14 is immobilized at 0.5 μg/mL(100 μL/well)can bind Recombinant Rat BTLA. The ED50 for this effect is approximately 1.083 μg/mL.
Species

Rat

Source

HEK293

Tag

C-mFc

Accession

Q6PNM1 (K30-Y183)

Gene ID
Molecular Construction
N-term
BTLA (K30-Y183)
Accession # Q6PNM1
mFc
C-term
Protein Length

Extracellular Domain

Synonyms
B- and T-lymphocyte attenuator; CD272; BTLA
AA Sequence

KEPTKRIGEECRVQLKIKRNSSRSAWTGELFKIECPVTYCVHRPNVTWCKHNGTRCVPLEVGPQLHTSWVENDQASAFVLYFEPIHLSDDGVYTCSANLNSEVINSHSVVIHVTERTQNCSEHPLITASDIPDATNASRPSTMEERPGRTWLLY

Molecular Weight

Approximately 55-77 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BTLA/CD272 Protein, Rat (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTLA/CD272 Protein, Rat (HEK293, mFc)
Cat. No.:
HY-P75466
Quantity:
MCE Japan Authorized Agent: