Copy Link Print Information

BTLA/CD272 Protein, Rat (HEK293, mFc)

Customer Review

Based on 1 Customer Validation

BTLA/CD272 protein inhibits antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It regulates immune responses through cis and trans interactions with TNFRSF14. In cis, it maintains resting state in naive T cells, while in trans, it supports survival signals in effector T cells. BTLA/CD272 interacts with PTPN6/SHP-1, PTPN11/SHP-2, and TNFRSF14/HVEM. BTLA/CD272 Protein, Rat (HEK293, mFc) is the recombinant rat-derived BTLA/CD272 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for BTLA/CD272 Protein, Rat (HEK293, mFc)
  • Experimental Validation Results for BTLA/CD272 Protein, Rat (HEK293, mFc)
  • BTLA/CD272 Protein, Rat (HEK293, mFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

BTLA/CD272 protein inhibits antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It regulates immune responses through cis and trans interactions with TNFRSF14. In cis, it maintains resting state in naive T cells, while in trans, it supports survival signals in effector T cells. BTLA/CD272 interacts with PTPN6/SHP-1, PTPN11/SHP-2, and TNFRSF14/HVEM. BTLA/CD272 Protein, Rat (HEK293, mFc) is the recombinant rat-derived BTLA/CD272 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

BTLA/CD272 protein serves as an inhibitory receptor on lymphocytes, exerting negative regulation on antigen receptor signaling through PTPN6/SHP-1 and PTPN11/SHP-2. It engages in both cis and trans interactions with TNFRSF14. In cis interactions, BTLA/CD272 plays an immune regulatory role, inhibiting trans interactions in naive T cells to maintain a resting state. Conversely, in trans interactions, it can predominate during adaptive immune responses, providing survival signals to effector T cells. The protein interacts with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 and also engages with TNFRSF14/HVEM through its cysteine-rich domain 1.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Mouse HVEM/TNFRSF14 is immobilized at 0.5 μg/mL(100 μL/well)can bind Recombinant Rat BTLA. The ED50 for this effect is approximately 1.083 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Mouse HVEM/TNFRSF14 is immobilized at 0.5 μg/mL（100 μL/well）can bind Recombinant Rat BTLA. The ED50 for this effect is approximately 1.083 μg/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-mFc
  • Accession

    Q6PNM1 (K30-Y183)

  • Gene ID
    407756  [NCBI]
  • Molecular Construction
    • N-term
    • BTLA (K30-Y183)
      Accession # Q6PNM1
    • mFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    BTLA; BTLA1; B And T Lymphocyte Associated; CD272; B- And T-Lymphocyte-Associated Protein; Alternative Protein BTLA; B- And T-Lymphocyte Attenuator; CD272 Antigen

  • AA Sequence

    KEPTKRIGEECRVQLKIKRNSSRSAWTGELFKIECPVTYCVHRPNVTWCKHNGTRCVPLEVGPQLHTSWVENDQASAFVLYFEPIHLSDDGVYTCSANLNSEVINSHSVVIHVTERTQNCSEHPLITASDIPDATNASRPSTMEERPGRTWLLY

  • Molecular Weight

    Approximately 55-77 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Mouse HVEM/TNFRSF14 is immobilized at 0.5 μg/mL（100 μL/well）can bind Recombinant Rat BTLA. The ED50 for this effect is approximately 1.083 μg/mL.

  • BTLA/CD272 Protein, Rat (HEK293, mFc) Product Image
    1/16
  • Experimental Validation Results for BTLA/CD272 Protein, Rat (HEK293, mFc)
  • Experimental Validation Results for BTLA/CD272 Protein, Rat (HEK293, mFc)
  • BTLA/CD272 Protein, Rat (HEK293, mFc) Product Image