BTN3A2 Protein, Human (HEK293, His)
BTN3A2 Protein, Human (HEK293, His) is a recombinant human BTN3A2 produced in HEK293 cells, with His tag. BTN3A2 is a member of butyrophilin family.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
BTN3A2 Protein, Human (HEK293, His) is a recombinant human BTN3A2 produced in HEK293 cells, with His tag. BTN3A2 is a member of butyrophilin family[1].
Background
Butyrophilins belonging to the immunoglobulin superfamily are new immune system regulators because they are present on lymphocytes, dendritic cells, monocytes, macrophages, neutrophils and eosinophils, and they exert a stimulatory and (or) inhibitory effect on them[1].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P78410-1 (Q30-W248)
-
Molecular Construction
-
N-term
-
BTN3A2 (Q30-W248)
Accession # P78410-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
BTN3A2; Butyrophilin, Subfamily 3, Member A2; Butyrophilin Subfamily 3 Member A2; Butyrophilin Protein; BTN3.2; CD277; BT3.2; BTF3; BTF4
-
AA Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
-
Predicted Molecular Mass
24.6 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
