C-MPL Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
C-MPL Protein, the receptor for thrombopoietin (TPO), is a key regulator of megakaryopoiesis and platelet production.It plays a crucial role in TPO-R-dependent immune responses and inhibits thrombopoietin signaling by facilitating the down-regulation of the full-length isoform Mpl-fl.C-MPL Protein, Mouse (HEK293, His) is the recombinant mouse-derived C-MPL protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
C-MPL Protein, the receptor for thrombopoietin (TPO), is a key regulator of megakaryopoiesis and platelet production.It plays a crucial role in TPO-R-dependent immune responses and inhibits thrombopoietin signaling by facilitating the down-regulation of the full-length isoform Mpl-fl.C-MPL Protein, Mouse (HEK293, His) is the recombinant mouse-derived C-MPL protein, expressed by HEK293 , with C-His labeled tag.
Background
C-MPL Protein serves as the receptor for thrombopoietin (TPO), functioning as a key regulator of megakaryopoiesis and platelet production. It plays a crucial role in TPO-R-dependent immune responses and acts as an inhibitor of thrombopoietin signaling by facilitating the down-regulation of the full-length isoform Mpl-fl.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q08351 (Q26-W482)
-
Molecular Construction
-
N-term
-
C-MPL (Q26-W482)
Accession # Q08351 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MPL; Myeloproliferative Leukemia Virus Oncogene; MPL Proto-Oncogene, Thrombopoietin Receptor; TPO-R; TPOR; Thrombopoietin Receptor Variant; Myeloproliferative Leukemia Protein; CD110 Antigen; Thrombopoietin Receptor; THCYT2; Proto-Oncogene C-Mpl; C-MPL; C
-
AA Sequence
QDVFLLALGTEPLNCFSQTFEDLTCFWDEEEAAPSGTYQLLYAYRGEKPRACPLYSQSVPTFGTRYVCQFPAQDEVRLFFPLHLWVKNVSLNQTLIQRVLFVDSVGLPAPPRVIKARGGSQPGELQIHWEAPAPEISDFLRHELRYGPTDSSNATAPSVIQLLSTETCCPTLWMPNPVPVLDQPPCVHPTASQPHGPAPFLTVKGGSCLVSGLQAGKSYWLQLRSQPDGVSLRGSWGPWSFPVTVDLPGDAVTIGLQCFTLDLKMVTCQWQQQDRTSSQGFFRHSRTRCCPTDRDPTWEKCEEEEPRPGSQPALVSRCHFKSRNDSVIHILVEVTTAQGAVHSYLGSPFWIHQAVLLPTPSLHWREVSSGRLELEWQHQSSWAAQETCYQLRYTGEGREDWKVLEPSLGARGGTLELRPRARYSLQLRARLNGPTYQGPWSAWSPPARVSTGSETAW
-
Predicted Molecular Mass
52.3 kDa
-
Molecular Weight
Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
