Copy Link Print Information

C1QB Protein, Human (sf9, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The C1QB protein plays a critical role in the assembly of C1, the initial component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QB Protein, Human (sf9, His) is the recombinant human-derived C1QB protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • C1QB Protein, Human (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The C1QB protein plays a critical role in the assembly of C1, the initial component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QB Protein, Human (sf9, His) is the recombinant human-derived C1QB protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

C1QB protein plays a crucial role in the formation of C1, the initial component of the serum complement system. C1q associates with the proenzymes C1r and C1s, resulting in the assembly of C1. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 occurs upon engagement of the globular heads of C1q with the Fc regions of IgG or IgM antibodies within immune complexes. C1, in its active form, constitutes a calcium-dependent trimolecular complex composed of C1q, C1r, and C1s in a molar ratio of 1:2:2. The C1q subcomponent consists of nine subunits, with six being disulfide-linked dimers of the A and B chains, and the remaining three forming disulfide-linked dimers of the C chain.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession

    P02746 (Q28-A253)

  • Gene ID
    713  [NCBI]
  • Molecular Construction
    • N-term
    • C1QB (Q28-A253)
      Accession # P02746
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    C1QB; Complement Subcomponent C1q Chain B; Complement C1q B Chain; Complement C1q Chain B; Complement Component 1, Q Subcomponent, Beta Polypeptide; Complement Component C1q, B Chain; Complement Component 1, Q Subcomponent, B Chain; C1QD2; Complement C1q

  • AA Sequence

    QLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA

  • Predicted Molecular Mass

    25.2 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 10% Glycerol, pH 7.5, 0.5 mM TCEP.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • C1QB Protein, Human (sf9, His) Product Image
    1/16
  • C1QB Protein, Human (sf9, His) Product Image