C1QB Protein, Human (sf9, His)

The C1QB protein plays a critical role in the assembly of C1, the initial component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QB Protein, Human (sf9, His) is the recombinant human-derived C1QB protein, expressed by Sf9 insect cells , with C-His labeled tag.

C1QB protein plays a crucial role in the formation of C1, the initial component of the serum complement system. C1q associates with the proenzymes C1r and C1s, resulting in the assembly of C1. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 occurs upon engagement of the globular heads of C1q with the Fc regions of IgG or IgM antibodies within immune complexes. C1, in its active form, constitutes a calcium-dependent trimolecular complex composed of C1q, C1r, and C1s in a molar ratio of 1:2:2. The C1q subcomponent consists of nine subunits, with six being disulfide-linked dimers of the A and B chains, and the remaining three forming disulfide-linked dimers of the C chain.

Human

Sf9 insect cells

C-His

P02746 (Q28-A253)

713  [NCBI]

Full Length of Mature Protein

QLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA

Approximately 30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 10% Glycerol, pH 7.5, 0.5 mM TCEP.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.