1. Recombinant Proteins
  2. Complement System
  3. Complement Component 1
  4. C1q
  5. Complement C1q B-Chain (C1QB)
  6. C1QB Protein, Human (sf9, His)

The C1QB protein plays a critical role in the assembly of C1, the initial component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QB Protein, Human (sf9, His) is the recombinant human-derived C1QB protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE C1QB Protein, Human (sf9, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The C1QB protein plays a critical role in the assembly of C1, the initial component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QB Protein, Human (sf9, His) is the recombinant human-derived C1QB protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

C1QB protein plays a crucial role in the formation of C1, the initial component of the serum complement system. C1q associates with the proenzymes C1r and C1s, resulting in the assembly of C1. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 occurs upon engagement of the globular heads of C1q with the Fc regions of IgG or IgM antibodies within immune complexes. C1, in its active form, constitutes a calcium-dependent trimolecular complex composed of C1q, C1r, and C1s in a molar ratio of 1:2:2. The C1q subcomponent consists of nine subunits, with six being disulfide-linked dimers of the A and B chains, and the remaining three forming disulfide-linked dimers of the C chain.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

P02746 (Q28-A253)

Gene ID

713  [NCBI]

Molecular Construction
N-term
C1QB (Q28-A253)
Accession # P02746
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Complement C1q subcomponent subunit B; C1QB
AA Sequence

QLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA

Molecular Weight

Approximately 30 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 10% Glycerol, pH 7.5, 0.5 mM TCEP.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

C1QB Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

C1QB Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
C1QB Protein, Human (sf9, His)
Cat. No.:
HY-P75464
Quantity:
MCE Japan Authorized Agent: