CADM3 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CADM3 protein is a multifunctional cell adhesion molecule that participates in calcium-independent homophilic and heterophilic intercellular adhesion together with IGSF4, NECTIN1, and NECTIN3. Its interaction with EPB41L1 regulates cell-cell connections. CADM3 Protein, Rat (HEK293, His) is the recombinant rat-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CADM3 protein is a multifunctional cell adhesion molecule that participates in calcium-independent homophilic and heterophilic intercellular adhesion together with IGSF4, NECTIN1, and NECTIN3. Its interaction with EPB41L1 regulates cell-cell connections. CADM3 Protein, Rat (HEK293, His) is the recombinant rat-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.
Background
CADM3, a cell adhesion molecule, intricately participates in cell-cell adhesion processes. It exhibits both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, NECTIN1, and NECTIN3, emphasizing its versatility in mediating diverse cell interactions. Furthermore, CADM3's interaction with EPB41L1 suggests a potential role in regulating the structure or function of cell-cell junctions. The protein forms homodimers and has the capacity to create trans-heterodimers with NECTIN3, highlighting its ability to engage in various adhesive interactions. Additionally, CADM3 interacts with EPB41L1, DLG3, PALS2, and CASK, further underscoring its involvement in intricate cellular signaling and junction dynamics. The multifaceted nature of CADM3 positions it as a key player in cell adhesion and intercellular communication.
Verified Bioactivity
Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.727 μg/mL, corresponding to a specific activity is 5790.388 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
Q1WIM3 (N23-H328)
-
Molecular Construction
-
N-term
-
CADM3 (N23-H328)
Accession # Q1WIM3 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CADM3; FLJ10698; Prev. IGSF4B; Nectin-Like Protein 1; SynCAM3; TSLC1-Like Protein 1; TSLL1; Nectin-Like 1; NECL1; TSLC1-Like 1; Necl-1; SYNCAM3; BIgR; CMT2FF; Immunoglobulin Superfamily Member 4B; NECL-1; Synaptic Cell Adhesion Molecule 3; IgSF4B; Brain I
-
AA Sequence
NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVSSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKETATLNCQSSGSKPAAQLAWRKGDQELHGDQTRIQEDPNGKTFTVSSSVSFQVTRDDDGANVVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPEPAHPREGQKLLLHCEGRGNPVPQQYVWVKEGSEPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYTAYFTLNVNDPSPVPSSSSTYH
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
