CADM3 Protein, Rat (HEK293, His)

CADM3 protein is a multifunctional cell adhesion molecule that participates in calcium-independent homophilic and heterophilic intercellular adhesion together with IGSF4, NECTIN1, and NECTIN3. Its interaction with EPB41L1 regulates cell-cell connections. CADM3 Protein, Rat (HEK293, His) is the recombinant rat-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.

CADM3, a cell adhesion molecule, intricately participates in cell-cell adhesion processes. It exhibits both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, NECTIN1, and NECTIN3, emphasizing its versatility in mediating diverse cell interactions. Furthermore, CADM3's interaction with EPB41L1 suggests a potential role in regulating the structure or function of cell-cell junctions. The protein forms homodimers and has the capacity to create trans-heterodimers with NECTIN3, highlighting its ability to engage in various adhesive interactions. Additionally, CADM3 interacts with EPB41L1, DLG3, PALS2, and CASK, further underscoring its involvement in intricate cellular signaling and junction dynamics. The multifaceted nature of CADM3 positions it as a key player in cell adhesion and intercellular communication.

Measured in a cell proliferation assay using SH-SY5Y cells. The ED₅₀ for this effect is 1.727 μg/mL, corresponding to a specific activity is 5790.388 units/mg.

• 
  Measured in a cell proliferation assay using SH-SY5Y cells. The ED₅₀ for this effect is 1.727 μg/mL, corresponding to a specific activity is 5790.388 units/mg.

Rat

HEK293

C-6*His

Q1WIM3 (N23-H328)

360882  [NCBI]

Extracellular Domain

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVSSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKETATLNCQSSGSKPAAQLAWRKGDQELHGDQTRIQEDPNGKTFTVSSSVSFQVTRDDDGANVVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPEPAHPREGQKLLLHCEGRGNPVPQQYVWVKEGSEPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYTAYFTLNVNDPSPVPSSSSTYH

Approximately 35-45 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.