Calcineurin B Protein, Human (His)
Based on 1 Customer Validation
Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].
Background
Calcineurin Subunit B Type 1, an anti-tumor factor, is upregulated by let-7e after LPS stimulation[1].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P63098 (M1-V170)
-
Molecular Construction
-
N-term
-
6*His
-
PPP3R1 (M1-V170)
Accession # P63098 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PPP3R1; Calcineurin Subunit B Type 1; Protein Phosphatase 3 Regulatory Subunit B, Alpha; Protein Phosphatase 3 (Formerly 2B), Regulatory Subunit B (19kD), Alpha Isoform (Calcineurin B, Type I); CNB; Protein Phosphatase 3 (Formerly 2B), Regulatory Subunit
-
AA Sequence
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
-
Predicted Molecular Mass
21.5 kDa
-
Molecular Weight
Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 2 mM DTT, pH 8.0 .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
