Calnexin Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Calnexin interacts with monoglucosylated glycoproteins, helping their assembly and retention in the endoplasmic reticulum (ER). Calnexin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Calnexin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Calnexin interacts with monoglucosylated glycoproteins, helping their assembly and retention in the endoplasmic reticulum (ER). Calnexin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Calnexin protein, expressed by HEK293 , with C-His labeled tag.

Background

Calnexin protein, a calcium-binding chaperone located in the endoplasmic reticulum (ER), plays a pivotal role in interacting with newly synthesized monoglucosylated glycoproteins, contributing to protein assembly and retention of unassembled protein subunits within the ER. With a key function in the ER's quality control apparatus, calnexin participates in the retention of incorrectly folded proteins. Notably, it associates with partial T-cell antigen receptor complexes in immature thymocytes, suggesting a role in signaling and regulation of thymocyte maturation. Additionally, calnexin may be involved in receptor-mediated endocytosis at the synapse. Its interactions extend to various proteins, including MAPK3/ERK1, KCNH2, SERPINA2P/SERPINA2, SGIP1, PPIB, SMIM22, TMX2, TMEM35A/NACHO, CHRNA7, RETREG2, RETREG3, DNM1L, and ADAM7, highlighting its versatility in forming complexes and participating in diverse cellular processes. The palmitoylated form specifically interacts with the ribosome-translocon complex component SSR1, promoting efficient folding of glycoproteins and emphasizing its role in protein maturation within the ER.

Verified Bioactivity

Measured by its ability to enhance the proliferation of SH-SY5Y cells. The ED50 for this effect is 10.92 ng/mL in the presence of 0.5 μg/mL PRNP, corresponding to a specific activity is 9.158×104 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to enhance the proliferation of SH-SY5Y cells. The ED50 for this effect is 10.92 ng/mL in the presence of 0.5 μg/mL PRNP, corresponding to a specific activity is 9.158×104 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Calnexin (H21-P482)
      Accession # P35564
    • His
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    CANX; Major Histocompatibility Complex Class I Antigen-Binding Protein P88; Calnexin; CNX; IP90; Epididymis Secretory Sperm Binding Protein; P90

  • AA Sequence

    HDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEERP

  • Molecular Weight

    Approximately 58-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00