Calnexin Protein, Mouse (HEK293, His)

Calnexin interacts with monoglucosylated glycoproteins, helping their assembly and retention in the endoplasmic reticulum (ER). Calnexin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Calnexin protein, expressed by HEK293 , with C-His labeled tag.

Calnexin protein, a calcium-binding chaperone located in the endoplasmic reticulum (ER), plays a pivotal role in interacting with newly synthesized monoglucosylated glycoproteins, contributing to protein assembly and retention of unassembled protein subunits within the ER. With a key function in the ER's quality control apparatus, calnexin participates in the retention of incorrectly folded proteins. Notably, it associates with partial T-cell antigen receptor complexes in immature thymocytes, suggesting a role in signaling and regulation of thymocyte maturation. Additionally, calnexin may be involved in receptor-mediated endocytosis at the synapse. Its interactions extend to various proteins, including MAPK3/ERK1, KCNH2, SERPINA2P/SERPINA2, SGIP1, PPIB, SMIM22, TMX2, TMEM35A/NACHO, CHRNA7, RETREG2, RETREG3, DNM1L, and ADAM7, highlighting its versatility in forming complexes and participating in diverse cellular processes. The palmitoylated form specifically interacts with the ribosome-translocon complex component SSR1, promoting efficient folding of glycoproteins and emphasizing its role in protein maturation within the ER.

Measured by its ability to enhance the proliferation of SH-SY5Y cells. The ED₅₀ for this effect is 10.92 ng/mL in the presence of 0.5 μg/mL PRNP, corresponding to a specific activity is 9.158×10⁴ units/mg.

• 
  Measured by its ability to enhance the proliferation of SH-SY5Y cells. The ED₅₀ for this effect is 10.92 ng/mL in the presence of 0.5 μg/mL PRNP, corresponding to a specific activity is 9.158×10⁴ units/mg.

Mouse

HEK293

C-10*His

P35564 (H21-P482)

12330  [NCBI]

Lumenal Domain

HDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEERP

Approximately 58-70 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.