Carboxyl Ester Lipase/CEL Protein, Mouse (sf9, His)
Carboxyester lipase/CEL protein plays a crucial role in cellular processes as it catalyzes the hydrolysis of a variety of substrates, including cholesterol esters, phospholipids, lysophospholipids, diacylglycerols and triacylglycerols, and lipids of hydroxy fatty acids acid ester. FAHF). Carboxyl Ester Lipase/CEL Protein, Mouse (sf9, His) is the recombinant mouse-derived Carboxyl Ester Lipase/CEL protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Carboxyester lipase/CEL protein plays a crucial role in cellular processes as it catalyzes the hydrolysis of a variety of substrates, including cholesterol esters, phospholipids, lysophospholipids, diacylglycerols and triacylglycerols, and lipids of hydroxy fatty acids acid ester. FAHF). Carboxyl Ester Lipase/CEL Protein, Mouse (sf9, His) is the recombinant mouse-derived Carboxyl Ester Lipase/CEL protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Carboxyl Ester Lipase (CEL) is an enzyme that catalyzes the hydrolysis of a diverse range of substrates, including cholesteryl esters, phospholipids, lysophospholipids, di- and tri-acylglycerols, and fatty acid esters of hydroxy fatty acids (FAHFAs). CEL exhibits a preference for FAHFAs with the ester bond positioned further away from the carboxylate group, and it hydrolyzes unsaturated FAHFAs more rapidly than saturated ones. This enzymatic activity is essential for the complete digestion of dietary lipids in the gastrointestinal tract and facilitates the absorption of fat-soluble vitamins. CEL's role in lipid metabolism underscores its significance in the overall process of nutrient absorption and highlights its importance in maintaining lipid homeostasis.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q64285 (M1-L534)
-
Gene ID12613 [NCBI]
-
Molecular Construction
-
N-term
-
CEL (M1-L534)
Accession # Q64285 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CEL; Carboxyl Ester Lipase (Bile Salt-Stimulated Lipase); Carboxyl Ester Lipase; Fetoacinar Pancreatic Protein; BSSL; Lysophospholipase, Pancreatic; MODY8; Pancreatic Lysophospholipase; Bile Salt-Stimulated Lipase; Carboxyl Ester Hydrolase; Bile Salt-Acti
-
AA Sequence
MGRLEVLFLGLTCCLAAACAAKLGAVYTEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAKTLENPQRHPGWQGTLKATNFKKRCLQATITQDNTYGQEDCLYLNIWVPQGRKQVSHNLPVMVWIYGGAFLMGSGQGANFLKNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPDNITIFGESAGAASVSLQTLSPYNKGLIRRAISQSGMALSPWAIQKNPLFWAKTIAKKVGCPTEDTGKMAACLKITDPRALTLAYKLPVKKQEYPVVHYLAFIPVIDGDFIPDDPINLYNNTADIDYIAGINNMDGHLFATIDVPAVDKTKQTVTEEDFYRLVSGHTVAKGLKGAQATFDIYTESWAQDPSQENMKKTVVAFETDVLFLIPTEIALAQHKAHAKSAKTYSYLFSHPSRMPIYPKWMGADHADDLQYVFGKPFATPLGYRPQDRAVSKAMIAYWTNFARSGDPNMGNSPVPTHWYPYTLENGNYLDITKTITSASMKEHL
-
Predicted Molecular Mass
58.2 kDa
-
Molecular Weight
Approximately 134 kDa & 59 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
