1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Carboxyl Ester Lipase/CEL Protein, Mouse (sf9, His)

Carboxyl Ester Lipase/CEL Protein, Mouse (sf9, His)

Cat. No.: HY-P74352
Handling Instructions Technical Support

Carboxyester lipase/CEL protein plays a crucial role in cellular processes as it catalyzes the hydrolysis of a variety of substrates, including cholesterol esters, phospholipids, lysophospholipids, diacylglycerols and triacylglycerols, and lipids of hydroxy fatty acids acid ester. FAHF). Carboxyl Ester Lipase/CEL Protein, Mouse (sf9, His) is the recombinant mouse-derived Carboxyl Ester Lipase/CEL protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Carboxyester lipase/CEL protein plays a crucial role in cellular processes as it catalyzes the hydrolysis of a variety of substrates, including cholesterol esters, phospholipids, lysophospholipids, diacylglycerols and triacylglycerols, and lipids of hydroxy fatty acids acid ester. FAHF). Carboxyl Ester Lipase/CEL Protein, Mouse (sf9, His) is the recombinant mouse-derived Carboxyl Ester Lipase/CEL protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Carboxyl Ester Lipase (CEL) is an enzyme that catalyzes the hydrolysis of a diverse range of substrates, including cholesteryl esters, phospholipids, lysophospholipids, di- and tri-acylglycerols, and fatty acid esters of hydroxy fatty acids (FAHFAs). CEL exhibits a preference for FAHFAs with the ester bond positioned further away from the carboxylate group, and it hydrolyzes unsaturated FAHFAs more rapidly than saturated ones. This enzymatic activity is essential for the complete digestion of dietary lipids in the gastrointestinal tract and facilitates the absorption of fat-soluble vitamins. CEL's role in lipid metabolism underscores its significance in the overall process of nutrient absorption and highlights its importance in maintaining lipid homeostasis.

Species

Mouse

Source

Sf9 insect cells

Tag

C-His

Accession

Q64285 (M1-L534)

Gene ID

12613  [NCBI]

Molecular Construction
N-term
CEL (M1-L534)
Accession # Q64285
His
C-term
Protein Length

Partial

Synonyms
Bile salt-activated lipase; BAL; BSSL; Cel; Lip1
AA Sequence

MGRLEVLFLGLTCCLAAACAAKLGAVYTEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAKTLENPQRHPGWQGTLKATNFKKRCLQATITQDNTYGQEDCLYLNIWVPQGRKQVSHNLPVMVWIYGGAFLMGSGQGANFLKNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPDNITIFGESAGAASVSLQTLSPYNKGLIRRAISQSGMALSPWAIQKNPLFWAKTIAKKVGCPTEDTGKMAACLKITDPRALTLAYKLPVKKQEYPVVHYLAFIPVIDGDFIPDDPINLYNNTADIDYIAGINNMDGHLFATIDVPAVDKTKQTVTEEDFYRLVSGHTVAKGLKGAQATFDIYTESWAQDPSQENMKKTVVAFETDVLFLIPTEIALAQHKAHAKSAKTYSYLFSHPSRMPIYPKWMGADHADDLQYVFGKPFATPLGYRPQDRAVSKAMIAYWTNFARSGDPNMGNSPVPTHWYPYTLENGNYLDITKTITSASMKEHL

Predicted Molecular Mass
58.2 kDa
Molecular Weight

Approximately 133.9 kDa & 59.1 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Carboxyl Ester Lipase/CEL Protein, Mouse (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Carboxyl Ester Lipase/CEL Protein, Mouse (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carboxyl Ester Lipase/CEL Protein, Mouse (sf9, His)
Cat. No.:
HY-P74352
Quantity:
MCE Japan Authorized Agent: