1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin B
  5. Cathepsin B Protein, Human (L26V, HEK293, His)

Cathepsin B Protein, a thiol protease, is crucial for intracellular protein degradation, cleaving matrix extracellular phosphoglycoprotein MEPE. It's implicated in solubilizing cross-linked TG/thyroglobulin in the thyroid follicle lumen. Associated with tumor invasion and metastasis, Cathepsin B signifies potential relevance in cancer-related pathways. Cathepsin B Protein, Human (L26V, HEK293, His) is the recombinant human-derived Cathepsin B protein, expressed by HEK293 , with C-His labeled tag and L26V mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Cathepsin B Protein, Human (L26V, HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cathepsin B Protein, a thiol protease, is crucial for intracellular protein degradation, cleaving matrix extracellular phosphoglycoprotein MEPE. It's implicated in solubilizing cross-linked TG/thyroglobulin in the thyroid follicle lumen. Associated with tumor invasion and metastasis, Cathepsin B signifies potential relevance in cancer-related pathways. Cathepsin B Protein, Human (L26V, HEK293, His) is the recombinant human-derived Cathepsin B protein, expressed by HEK293 , with C-His labeled tag and L26V mutation.

Background

Cathepsin B Protein, a thiol protease, is thought to play a crucial role in intracellular protein degradation and turnover. This enzyme cleaves matrix extracellular phosphoglycoprotein MEPE and is implicated in the solubilization of cross-linked TG/thyroglobulin within the thyroid follicle lumen. Beyond its role in cellular processes, Cathepsin B has been associated with tumor invasion and metastasis, highlighting its potential significance in cancer-related pathways.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate 40 µM Z-LR-AMC(HY-142021). That incubate at room temperaturein kinetic mode for 5 minutes. Read at excitation and emission wavelengths of 380 nm and 460 nm. The specific activity is >2500 pmol/min/µg, as measured under the described conditions. (Activation description: The protein needs to be activated by Activation Buffer for an activated form.)

  • Measured by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC. Read at excitation and emission wavelengths of 380 nm and 460 nm. The specific activity is 13852.704 pmol/min/µg, as measured under the described conditions.
Species

Human

Source

HEK293

Tag

C-His

Accession

P07858 (R18-I339, L26V)

Gene ID
Molecular Construction
N-term
Cathepsin B (R18-I339, L26V)
Accession # P07858
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
CTSB; CPSB; APPS
AA Sequence

RSRPSFHPVSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

Molecular Weight

Approximately 37-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Structure/Form
Pro-form
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cathepsin B Protein, Human (L26V, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Cathepsin B Protein, Human (L26V, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin B Protein, Human (L26V, HEK293, His)
Cat. No.:
HY-P78682
Quantity:
MCE Japan Authorized Agent: