CCL24/Eotaxin-2 Protein, Mouse
Based on 2 publication(s) in Google Scholar
CCL24/Eotaxin-2 Protein, Mouse is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by E. coli.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
CCL24/Eotaxin-2 Protein, Mouse is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by E. coli[1].
CCL24, also known as eosinophil chemotactic protein 2 (eotaxin-2) and myeloid progenitor inhibitory factor 2 (MPIF-2), is a small cytokine of the CC chemokine family, located on chromosome 7 in the human genome. CCL24 is highly chemotactic for resting T lymphocytes and eosinophils and has low chemotactic activity for neutrophils, but not for monocytes and activated lymphocytes. By binding to its sole receptor CCR3, of which CCR3, is present mainly on eosinophils, but also on basophils, monocytes, Th2 lymphocytes, epithelial cells and airway smooth muscle. CCL24 mainly mediates atopic diseases, parasitic infections and systemic diseases, but also promotes cellular transport and regulates inflammatory and fibrotic activities[1][2].
CCL24 deficiency leads to reduced dermal thickness and infiltration of immune cells into the bronchoalveolar lavage (BAL) fluid and significantly reduced α-SMA expression in a mouse model of bleomycin (BLM)-induced skin fibrosis[3].
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Cell Death Dis
Mechanical stiffness promotes skin fibrosis via Piezo1-Wnt2/Wnt11-CCL24 positive feedback loop. [Abstract]2024 Jan 24;15(1):84. PMID: 38267432 -
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9JKC0 (V27-V119)
-
Molecular Construction
-
N-term
-
CCL24 (V27-V119)
Accession # Q9JKC0 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL24; CK-Beta-6; Prev. SCYA24; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 24; Eotaxin-2; Eosinophil Chemotactic Protein 2; MPIF-2; Chemokine (C-C Motif) Ligand 24; MPIF2; Small-Inducible Cytokine A24; Myeloid Progenitor Inhibitory Factor 2; C
-
AA Sequence
VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
-
Predicted Molecular Mass
10.3 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6(6):1028-37. [Content Brief]
[2]. Amanda K Huber, et al. An emerging role for eotaxins in neurodegenerative disease. Clin Immunol. 2018 Apr;189:29-33. [Content Brief]
[3]. Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2(1):100064. [Content Brief]
[4]. Adi Mor. et al. Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis. Ann Rheum Dis. 2019 Sep;78(9):1260-1268. [Content Brief]
[5]. Adi Mor, et al. Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis. Ann Rheum Dis. 2019 Sep;78(9):1260-1268. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
