CCR8 Protein, Cynomolgus (HEK293, mFc)
CCR8 is part of the G-protein coupled receptor 1 family. CCR8 Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived CCR8 protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CCR8 is part of the G-protein coupled receptor 1 family. CCR8 Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived CCR8 protein, expressed by HEK293 , with C-mFc labeled tag.
Background
CCR8, also known as C-C chemokine receptor type 8, is a member of the G-protein coupled receptor 1 (GPCR1) family. GPCRs constitute a diverse family of cell surface receptors that play pivotal roles in signal transduction across the cell membrane. Specifically, CCR8 is involved in mediating the effects of chemokines, which are small proteins that regulate immune cell trafficking and function. As a GPCR, CCR8 is characterized by its seven-transmembrane domains, and upon ligand binding, it activates intracellular signaling cascades, influencing cellular responses. CCR8 is associated with the recruitment and activation of immune cells, participating in inflammatory and immune processes. Understanding the function and regulation of CCR8 can offer insights into immune system modulation and may have implications in various physiological and pathological conditions.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-mFc
-
Accession
O97665/XP_015300839.1 (M1-K35)
-
Molecular Construction
-
N-term
-
CCR8 (M1-K35)
Accession # XP_015300839.1 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CCR8; Chemokine Receptor-Like 1; Prev. CMKBRL2; GPRCY6; Prev. CMKBR8; CCR-8; TER1; CKRL1; C-C Chemokine Receptor Type 8; Chemokine (C-C) Receptor-Like 2; GPR-CY6; CC-Chemokine Receptor Chemr1; CKR-L1; Chemokine (C-C) Receptor 8; CDw198; CC Chemokine Recep
-
AA Sequence
MDYTLDPSMTTMTDYYYPDSLSSPCDGELIQRNDK
-
Predicted Molecular Mass
29.7 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
