CCR8 Protein, Cynomolgus (HEK293, mFc)

CCR8 is part of the G-protein coupled receptor 1 family. CCR8 Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived CCR8 protein, expressed by HEK293 , with C-mFc labeled tag.

CCR8, also known as C-C chemokine receptor type 8, is a member of the G-protein coupled receptor 1 (GPCR1) family. GPCRs constitute a diverse family of cell surface receptors that play pivotal roles in signal transduction across the cell membrane. Specifically, CCR8 is involved in mediating the effects of chemokines, which are small proteins that regulate immune cell trafficking and function. As a GPCR, CCR8 is characterized by its seven-transmembrane domains, and upon ligand binding, it activates intracellular signaling cascades, influencing cellular responses. CCR8 is associated with the recruitment and activation of immune cells, participating in inflammatory and immune processes. Understanding the function and regulation of CCR8 can offer insights into immune system modulation and may have implications in various physiological and pathological conditions.

Cynomolgus

HEK293

C-mFc

O97665/XP_015300839.1 (M1-K35)

102132857  [NCBI]

Extracellular Domain

MDYTLDPSMTTMTDYYYPDSLSSPCDGELIQRNDK

Approximately 35-45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.