1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Endothelial cell CD Proteins
  4. CD160
  5. CD160 Protein, Human (Biotinylateds, HEK293, His-Avi)

CD160 Protein, Human (Biotinylateds, HEK293, His-Avi)

Cat. No.: HY-P704593
Handling Instructions Technical Support

The CD160 protein is found on immune cells and acts as a receptor that transmits stimulatory or inhibitory signals, complexly regulating cell activation and differentiation. It exists in a GPI-anchored and transmembrane form and may initiate different signaling pathways in NK cells and T cells. CD160 Protein, Human (Biotinylateds, HEK293, His-Avi) is the recombinant human-derived CD160 protein, expressed by HEK293, with C-Avi and C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD160 protein is found on immune cells and acts as a receptor that transmits stimulatory or inhibitory signals, complexly regulating cell activation and differentiation. It exists in a GPI-anchored and transmembrane form and may initiate different signaling pathways in NK cells and T cells. CD160 Protein, Human (Biotinylateds, HEK293, His-Avi) is the recombinant human-derived CD160 protein, expressed by HEK293, with C-Avi and C-His labeled tag.

Background

CD160 Protein, found on immune cells, serves as a receptor capable of delivering stimulatory or inhibitory signals that intricately regulate cell activation and differentiation. Existing in both GPI-anchored and transmembrane forms, each likely initiating distinct signaling pathways in activated NK cells via phosphoinositide 3-kinase and in activated T cells via LCK and CD247/CD3 zeta chain. It acts as a receptor for both classical and non-classical MHC class I molecules, recognizing HLA-C during acute viral infections and triggering NK cell cytotoxic activity, contributing to the anti-viral innate immune response. On CD8+ T cells, CD160 binds HLA-A2-B2M, providing a costimulatory signal to activated/memory T cells. However, during persistent antigen stimulation, as observed in chronic viral infections, it may progressively inhibit TCR signaling in memory CD8+ T cells, contributing to T cell exhaustion. On endothelial cells, CD160 recognizes HLA-G, controlling angiogenesis in immune privileged sites. It also acts as a receptor or ligand for TNFRSF14, participating in bidirectional cell-cell contact signaling between antigen-presenting cells and lymphocytes, modulating immune responses in various contexts, including anti-tumor responses and bacterial infections. The soluble GPI-cleaved form, typically released by activated lymphocytes, might play a role in immune regulation by limiting lymphocyte effector functions.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

O95971-1 (G25-L158)

Gene ID

11126

Molecular Construction
N-term
CD160 (G25-L158)
Accession # O95971-1
Avi
His
C-term
Protein Length

Full Length of CD160 antigen

Conjugation

Biotin

Synonyms
rMuCD160, His; CD160 antigen; CD160
AA Sequence

GCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTL

Predicted Molecular Mass
17.7 kDa
Molecular Weight

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD160 Protein, Human (Biotinylateds, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD160 Protein, Human (Biotinylateds, HEK293, His-Avi)
Cat. No.:
HY-P704593
Quantity:
MCE Japan Authorized Agent: