CD160 Protein, Human (Biotinylateds, HEK293, His-Avi)

The CD160 protein is found on immune cells and acts as a receptor that transmits stimulatory or inhibitory signals, complexly regulating cell activation and differentiation. It exists in a GPI-anchored and transmembrane form and may initiate different signaling pathways in NK cells and T cells. CD160 Protein, Human (Biotinylateds, HEK293, His-Avi) is the recombinant human-derived CD160 protein, expressed by HEK293, with C-Avi and C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD160 protein is found on immune cells and acts as a receptor that transmits stimulatory or inhibitory signals, complexly regulating cell activation and differentiation. It exists in a GPI-anchored and transmembrane form and may initiate different signaling pathways in NK cells and T cells. CD160 Protein, Human (Biotinylateds, HEK293, His-Avi) is the recombinant human-derived CD160 protein, expressed by HEK293, with C-Avi and C-His labeled tag.

Background

CD160 Protein, found on immune cells, serves as a receptor capable of delivering stimulatory or inhibitory signals that intricately regulate cell activation and differentiation. Existing in both GPI-anchored and transmembrane forms, each likely initiating distinct signaling pathways in activated NK cells via phosphoinositide 3-kinase and in activated T cells via LCK and CD247/CD3 zeta chain. It acts as a receptor for both classical and non-classical MHC class I molecules, recognizing HLA-C during acute viral infections and triggering NK cell cytotoxic activity, contributing to the anti-viral innate immune response. On CD8+ T cells, CD160 binds HLA-A2-B2M, providing a costimulatory signal to activated/memory T cells. However, during persistent antigen stimulation, as observed in chronic viral infections, it may progressively inhibit TCR signaling in memory CD8+ T cells, contributing to T cell exhaustion. On endothelial cells, CD160 recognizes HLA-G, controlling angiogenesis in immune privileged sites. It also acts as a receptor or ligand for TNFRSF14, participating in bidirectional cell-cell contact signaling between antigen-presenting cells and lymphocytes, modulating immune responses in various contexts, including anti-tumor responses and bacterial infections. The soluble GPI-cleaved form, typically released by activated lymphocytes, might play a role in immune regulation by limiting lymphocyte effector functions.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD160 (G25-L158)
      Accession # O95971-1
    • Avi
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Conjugation

    Biotin

  • Synonyms

    CD160; NK28; CD160 Molecule; NK1; CD160 Antigen; Natural Killer Cell Receptor, Immunoglobulin Superfamily Member; BY55; CD160-Delta Ig; Natural Killer Cell Receptor BY55

  • AA Sequence

    GCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTL

  • Predicted Molecular Mass

    17.7 kDa

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00