CD1D Protein, Human (His-SUMO)

The CD1D protein, a key antigen-presenting molecule, binds self and non-self glycolipids, presenting them to T-cell receptors on natural killer T-cells. Partnering with B2M, it centrally orchestrates immune responses, and its interactions with MHC II emphasize its significance in the intricate network of immune system regulation. CD1D Protein, Human (His-SUMO) is the recombinant human-derived CD1D, expressed by E. coli, with N-6*His, N-SUMO labeled tag. The total length of CD1D Protein, Human (His-SUMO) is 282 a.a..

The CD1D-B2M heterodimer protein is a crucial antigen-presenting molecule that exhibits the unique ability to bind both self and non-self glycolipids, facilitating their presentation to T-cell receptors on natural killer T-cells. Forming a heterodimeric complex with B2M (beta-2-microglobulin), this protein plays a central role in orchestrating immune responses. Its interactions with MHC II further contribute to its significance in the intricate network of immune system regulation.

Human

E. coli

N-6*His;N-SUMO

P15813 (E20-S301)

912

Extracellular Domain

EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.