CD1D Protein, Human (His-SUMO)
The CD1D protein, a key antigen-presenting molecule, binds self and non-self glycolipids, presenting them to T-cell receptors on natural killer T-cells. Partnering with B2M, it centrally orchestrates immune responses, and its interactions with MHC II emphasize its significance in the intricate network of immune system regulation. CD1D Protein, Human (His-SUMO) is the recombinant human-derived CD1D, expressed by E. coli, with N-6*His, N-SUMO labeled tag. The total length of CD1D Protein, Human (His-SUMO) is 282 a.a..
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD1D protein, a key antigen-presenting molecule, binds self and non-self glycolipids, presenting them to T-cell receptors on natural killer T-cells. Partnering with B2M, it centrally orchestrates immune responses, and its interactions with MHC II emphasize its significance in the intricate network of immune system regulation. CD1D Protein, Human (His-SUMO) is the recombinant human-derived CD1D, expressed by E. coli, with N-6*His, N-SUMO labeled tag. The total length of CD1D Protein, Human (His-SUMO) is 282 a.a..
Background
The CD1D-B2M heterodimer protein is a crucial antigen-presenting molecule that exhibits the unique ability to bind both self and non-self glycolipids, facilitating their presentation to T-cell receptors on natural killer T-cells. Forming a heterodimeric complex with B2M (beta-2-microglobulin), this protein plays a central role in orchestrating immune responses. Its interactions with MHC II further contribute to its significance in the intricate network of immune system regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P15813 (E20-S301)
-
Gene ID912
-
Protein Length
Extracellular Domain
-
Synonyms
CD1D; HMC Class I Antigen-Like Glycoprotein CD1D; CD1d Molecule; T-Cell Surface Glycoprotein CD1d; Antigen-Presenting Glycoprotein CD1d; Thymocyte Antigen CD1D; CD1D Antigen, D Polypeptide; CD1d; CD1d Antigen; R3; R3G1
-
AA Sequence
EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS
-
Predicted Molecular Mass
47.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)