Copy Link Print Information

CD2 Protein, Rat (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

CD2 Protein, a cell surface glycoprotein, mediates T-cell activation and adhesion by binding to its ligand, CD58. It facilitates immune responses and intercellular communication. CD2 Protein is a promising target for immunotherapy and may lead to innovative treatments for immune-related disorders. CD2 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD2 Protein, Rat (HEK293, Fc)
  • Experimental Validation Results for CD2 Protein, Rat (HEK293, Fc)
  • CD2 Protein, Rat (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD2 Protein, a cell surface glycoprotein, mediates T-cell activation and adhesion by binding to its ligand, CD58. It facilitates immune responses and intercellular communication. CD2 Protein is a promising target for immunotherapy and may lead to innovative treatments for immune-related disorders. CD2 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD2 protein plays a crucial role in facilitating adhesion between T-cells and various cell types through its interactions with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1. It is also involved in triggering T-cells and transmitting signals via its cytoplasmic domain. Additionally, CD2 interacts with CD48, CD58 (LFA-3), CD2AP, and PSTPIP1, suggesting their potential involvement in related cellular processes. Notably, the interaction between CD2 and FCGR3A can modulate NK cell activation and cytotoxicity.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rat CD2, at 2μg/mL (100μL/well) can bind Anti-CD2 antibody. The ED50 for this effect is 1.486 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Rat CD2, at 2 μg/mL (100μL/well) can bind Anti-CD2 antibody. The ED50 for this effect is 1.486 μg/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q5I0M6 (R23-P202)

  • Gene ID
    497761  [NCBI]
  • Molecular Construction
    • N-term
    • CD2 (R23-P202)
      Accession # Q5I0M6
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD2; Rosette Receptor; Prev. SRBC; LFA-2; T-Cell Surface Antigen CD2; Lymphocyte-Function Antigen-2; CD2 Antigen (P50), Sheep Red Blood Cell Receptor; CD2 Antigen; T-Cell Surface Antigen T11/Leu-5; T11; Erythrocyte Receptor; CD2 Molecule; LFA-3 Receptor

  • AA Sequence

    RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCPEKGLP

  • Molecular Weight

    Approximately 58-64 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Rat CD2, at 2 μg/mL (100μL/well) can bind Anti-CD2 antibody. The ED50 for this effect is 1.486 μg/mL.

  • CD2 Protein, Rat (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for CD2 Protein, Rat (HEK293, Fc)
  • Experimental Validation Results for CD2 Protein, Rat (HEK293, Fc)
  • CD2 Protein, Rat (HEK293, Fc) Product Image