CD200 Protein, Human (HEK293, Fc-Avi)
CD200 Protein stimulates T-cell proliferation and regulates myeloid cell activity in tissues. It interacts with CD200R1 through their Ig-like domains, indicating its role in immune response modulation and maintaining cellular homeostasis. CD200 Protein, Human (HEK293, Fc-Avi) is the recombinant human-derived CD200 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD200 Protein stimulates T-cell proliferation and regulates myeloid cell activity in tissues. It interacts with CD200R1 through their Ig-like domains, indicating its role in immune response modulation and maintaining cellular homeostasis. CD200 Protein, Human (HEK293, Fc-Avi) is the recombinant human-derived CD200 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
Background
CD200 Protein acts as a potent costimulator for T-cell proliferation and is implicated in regulating myeloid cell activity across various tissues. Its functional interplay with CD200R1 is facilitated through the interaction of their N-terminal Ig-like domains, suggesting a pivotal role in modulating immune responses and maintaining homeostasis within diverse cellular environments.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-hFc
-
Accession
P41217-1/NP_005935.4 (Q31-G232)
-
Molecular Construction
-
N-term
-
CD200 (Q31-G232)
Accession # P41217-1/NP_005935.4 -
hFc-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD200; CD200 Antigen; Prev. MOX1; MRC; Prev. MOX2; Antigen Identified By Monoclonal Antibody MRC OX-2; OX-2 Membrane Glycoprotein; CD200 Antigen, Isoform CRA_b; CD200 Molecule; OX-2
-
AA Sequence
QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
-
Predicted Molecular Mass
51 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
