CD200 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
CD200 Protein stimulates T-cell proliferation and regulates myeloid cell activity in tissues. It interacts with CD200R1 through their Ig-like domains, indicating its role in immune response modulation and maintaining cellular homeostasis. CD200 Protein, Human (HEK293, Fc) is the recombinant human-derived CD200 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD200 Protein stimulates T-cell proliferation and regulates myeloid cell activity in tissues. It interacts with CD200R1 through their Ig-like domains, indicating its role in immune response modulation and maintaining cellular homeostasis. CD200 Protein, Human (HEK293, Fc) is the recombinant human-derived CD200 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD200 Protein acts as a potent costimulator for T-cell proliferation and is implicated in regulating myeloid cell activity across various tissues. Its functional interplay with CD200R1 is facilitated through the interaction of their N-terminal Ig-like domains, suggesting a pivotal role in modulating immune responses and maintaining homeostasis within diverse cellular environments.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P41217-1 (Q31-G232)
-
Molecular Construction
-
N-term
-
CD200 (Q31-G232)
Accession # P41217-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD200; CD200 Antigen; Prev. MOX1; MRC; Prev. MOX2; Antigen Identified By Monoclonal Antibody MRC OX-2; OX-2 Membrane Glycoprotein; CD200 Antigen, Isoform CRA_b; CD200 Molecule; OX-2
-
AA Sequence
QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
-
Predicted Molecular Mass
49.5 kDa
-
Molecular Weight
Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
