1. Recombinant Proteins
  2. Immune Checkpoint Proteins Receptor Proteins
  3. Stimulatory Immune Checkpoint Molecules
  4. CD200R
  5. CD200R4
  6. CD200R4 Protein, Mouse (HEK293, Fc)

The CD200R4 protein significantly contributes to TYROBP receptor recruitment or surface expression, suggesting its role in immune regulation or signaling processes. Molecular interactions with TYROBP underscore the function of CD200R4, which may influence downstream cellular responses and mediate TYROBP-related signaling events. CD200R4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD200R4 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD200R4 protein significantly contributes to TYROBP receptor recruitment or surface expression, suggesting its role in immune regulation or signaling processes. Molecular interactions with TYROBP underscore the function of CD200R4, which may influence downstream cellular responses and mediate TYROBP-related signaling events. CD200R4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD200R4 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CD200R4 Protein plays a significant role in the recruitment or surface expression of the TYROBP receptor, indicating its involvement in cellular processes related to immune regulation or signaling. The interaction with TYROBP underlines the molecular association that contributes to the functionality of CD200R4, potentially influencing downstream cellular responses. This interaction suggests a role for CD200R4 in mediating signaling events associated with TYROBP, highlighting its importance in immune modulation or other cellular activities that involve TYROBP signaling pathways.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q6XJV4 (T26-T241)

Gene ID

239849  [NCBI]

Molecular Construction
N-term
CD200R4 (T26-T241)
Accession # Q6XJV4
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Cell surface glycoprotein CD200 receptor 4; CD200RLa; Cd200r4
AA Sequence

TDENQTIQNDSSSSLTQVNTTMSVQMDKKALLCCFSSPLINAVLITWIIKHRHLPSCTIAYNLDKKTNETSCLGRNITWASTPDHSPELQISAVALQHEGTYTCEIVTPEGNLEKVYDLQVLVPPEVTYFPGKNRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSVVSCLVSHSTGNQSLSIELSQGTMTTPRSLLT

Predicted Molecular Mass
50.6 kDa
Molecular Weight

Approximately 80-90 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD200R4 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD200R4 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD200R4 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77317
Quantity:
MCE Japan Authorized Agent: