CD200R4 Protein, Mouse (HEK293, Fc)
The CD200R4 protein significantly contributes to TYROBP receptor recruitment or surface expression, suggesting its role in immune regulation or signaling processes. Molecular interactions with TYROBP underscore the function of CD200R4, which may influence downstream cellular responses and mediate TYROBP-related signaling events. CD200R4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD200R4 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD200R4 protein significantly contributes to TYROBP receptor recruitment or surface expression, suggesting its role in immune regulation or signaling processes. Molecular interactions with TYROBP underscore the function of CD200R4, which may influence downstream cellular responses and mediate TYROBP-related signaling events. CD200R4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD200R4 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The CD200R4 Protein plays a significant role in the recruitment or surface expression of the TYROBP receptor, indicating its involvement in cellular processes related to immune regulation or signaling. The interaction with TYROBP underlines the molecular association that contributes to the functionality of CD200R4, potentially influencing downstream cellular responses. This interaction suggests a role for CD200R4 in mediating signaling events associated with TYROBP, highlighting its importance in immune modulation or other cellular activities that involve TYROBP signaling pathways.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q6XJV4 (T26-T241)
-
Gene ID239849 [NCBI]
-
Molecular Construction
-
N-term
-
CD200R4 (T26-T241)
Accession # Q6XJV4 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Cell surface glycoprotein CD200 receptor 4; CD200 cell surface glycoprotein receptor-like 4; CD200 receptor-like 4; CD200 cell surface glycoprotein receptor-like a; CD200RLa; Cell surface glycoprotein OX2 receptor 4; Cd200r4
-
AA Sequence
TDENQTIQNDSSSSLTQVNTTMSVQMDKKALLCCFSSPLINAVLITWIIKHRHLPSCTIAYNLDKKTNETSCLGRNITWASTPDHSPELQISAVALQHEGTYTCEIVTPEGNLEKVYDLQVLVPPEVTYFPGKNRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSVVSCLVSHSTGNQSLSIELSQGTMTTPRSLLT
-
Predicted Molecular Mass
50.6 kDa
-
Molecular Weight
Approximately 80-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
