CD200R4 Protein, Mouse (HEK293, His)

The CD200R4 protein significantly contributes to TYROBP receptor recruitment or surface expression, suggesting its role in immune regulation or signaling processes. Molecular interactions with TYROBP underscore the function of CD200R4, which may influence downstream cellular responses and mediate TYROBP-related signaling events. CD200R4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R4 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD200R4 Protein, Mouse (HEK293, His) is 216 a.a., with molecular weight of ~40-75 kDa.

The CD200R4 Protein plays a significant role in the recruitment or surface expression of the TYROBP receptor, indicating its involvement in cellular processes related to immune regulation or signaling. The interaction with TYROBP underlines the molecular association that contributes to the functionality of CD200R4, potentially influencing downstream cellular responses. This interaction suggests a role for CD200R4 in mediating signaling events associated with TYROBP, highlighting its importance in immune modulation or other cellular activities that involve TYROBP signaling pathways.

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD200 R4 is present at 0.5 μg/mL can bind Recombinant Mouse CD200. The ED₅₀ for this effect is 1.23 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD200 R4 is present at 0.5 μg/mL can bind Recombinant Mouse CD200. The ED₅₀ for this effect is 1.23 μg/mL.

Mouse

HEK293

C-His

Q6XJV4 (T26-T241)

239849  [NCBI]

TDENQTIQNDSSSSLTQVNTTMSVQMDKKALLCCFSSPLINAVLITWIIKHRHLPSCTIAYNLDKKTNETSCLGRNITWASTPDHSPELQISAVALQHEGTYTCEIVTPEGNLEKVYDLQVLVPPEVTYFPGKNRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSVVSCLVSHSTGNQSLSIELSQGTMTTPRSLLT

The protein migrates as an approximately 40-75 kDa band under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.