CD3 epsilon Protein, Cynomolgus (HEK293, His)

The CD3E/CD3 epsilon 1-27 peptide is critical in the TCR-CD3 complex, transmitting signals during T cell activation. When APC activates the TCR, CD3E undergoes LCK/FYN-mediated phosphorylation together with ITAM, initiating downstream signaling. CD3 epsilon Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD3 epsilon protein, expressed by HEK293 , with C-His labeled tag.

The CD3E/CD3 epsilon 1-27 peptide, integral to the TCR-CD3 complex on T-lymphocyte cell surfaces, plays a crucial role in adaptive immune responses. Upon activation by antigen-presenting cells (APCs), the T-cell receptor (TCR) transmits signals across the cell membrane through CD3 chains, including CD3D, CD3E, CD3G, and CD3Z, each containing immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domains. Phosphorylation of these ITAMs by Src family protein tyrosine kinases LCK and FYN, upon TCR engagement, activates downstream signaling pathways. Beyond its role in signal transduction, CD3E is indispensable for correct T-cell development, initiating the assembly of the TCR-CD3 complex by forming heterodimers CD3D/CD3E and CD3G/CD3E. Additionally, CD3E participates in the internalization and cell surface down-regulation of TCR-CD3 complexes through endocytosis sequences in its cytosolic region. The TCR-CD3 complex, comprising CD3D/CD3E and CD3G/CD3E heterodimers, preferentially associates with TCRalpha and TCRbeta, forming trimers. This hexamer then interacts with CD3Z homodimers to complete the TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta. The CD3E/CD3 epsilon 1-27 peptide also interacts with CD6, NCK1, and NUMB, with the NUMB interaction being crucial for TCR-CD3 internalization and subsequent degradation.

Immobilized Cynomolgus CD3E, His Tag at 0.5μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Anti-CD3 Antibody, mFc Tag with the EC₅₀ of 32.7ng/ml determined by ELISA.

Cynomolgus

HEK293

C-6*His

Q95LI5 (Q22-D117)

102133065  [NCBI]

Extracellular Domain

QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD

Approximately 14-16 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.