CD300a/LMIR1 Protein, Human (HEK293, His)
CD300a/LMIR1 Protein, an inhibitory receptor, potentially diminishes cytolytic activity in NK cells and suppresses mast cell degranulation. It serves as a negative regulator in MYD88-mediated TLR signaling, activating PTPN6 but not TRIF. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D, showcasing its multifaceted involvement in immune regulation and cellular responses. CD300a/LMIR1 Protein, Human (HEK293, His) is the recombinant human-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD300a/LMIR1 Protein, an inhibitory receptor, potentially diminishes cytolytic activity in NK cells and suppresses mast cell degranulation. It serves as a negative regulator in MYD88-mediated TLR signaling, activating PTPN6 but not TRIF. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D, showcasing its multifaceted involvement in immune regulation and cellular responses. CD300a/LMIR1 Protein, Human (HEK293, His) is the recombinant human-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CD300a/LMIR1, an inhibitory receptor, potentially plays a role in diminishing cytolytic activity in natural killer (NK) cells and suppressing mast cell degranulation. Additionally, it acts as a negative regulator in Toll-like receptor (TLR) signaling mediated by MYD88, although not TRIF, by activating PTPN6. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1 and PTPN11/SHP-2, as well as INPP5D, illustrating its multifaceted involvement in immune regulation and cellular responses.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9UGN4-1 (L18-Q178)
-
Molecular Construction
-
N-term
-
CD300A (L18-Q178)
Accession # Q9UGN4-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD300A; CMRF35-Like Molecule 8; CD300a Molecule; NK Inhibitory Receptor; CMRF-35-H9; CMRF35-H9; CMRF35H; IRC1/IRC2; IGSF12; CMRF35-H; CD300a Antigen; CLM-8; Irp60; CMRF35H Leukocyte Immunoglobulin-Like Receptor; IRC1; Leukocyte Membrane Antigen; IRC2; CMR
-
AA Sequence
LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ
-
Predicted Molecular Mass
18.5 kDa
-
Molecular Weight
Approximately 23-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
