CD300a/LMIR1 Protein, Human (HEK293, His)

CD300a/LMIR1 Protein, an inhibitory receptor, potentially diminishes cytolytic activity in NK cells and suppresses mast cell degranulation. It serves as a negative regulator in MYD88-mediated TLR signaling, activating PTPN6 but not TRIF. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D, showcasing its multifaceted involvement in immune regulation and cellular responses. CD300a/LMIR1 Protein, Human (HEK293, His) is the recombinant human-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-6*His labeled tag.

CD300a/LMIR1, an inhibitory receptor, potentially plays a role in diminishing cytolytic activity in natural killer (NK) cells and suppressing mast cell degranulation. Additionally, it acts as a negative regulator in Toll-like receptor (TLR) signaling mediated by MYD88, although not TRIF, by activating PTPN6. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1 and PTPN11/SHP-2, as well as INPP5D, illustrating its multifaceted involvement in immune regulation and cellular responses.

Human

HEK293

C-6*His

Q9UGN4-1 (L18-Q178)

11314  [NCBI]

Extracellular Domain

LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ

Approximately 23-37 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.