Copy Link Print Information

CD302/CLEC13A Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD302/CLEC13A Protein, Rat (HEK293, His)
  • CD302/CLEC13A Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Background

CD302/CLEC13A Protein emerges as a potential multifunctional C-type lectin receptor, suggesting its versatile involvement in various cellular processes. The protein exhibits potential roles in endocytosis and phagocytosis, indicating its participation in cellular clearance mechanisms. Moreover, CD302/CLEC13A is implicated in cell adhesion and migration, hinting at its possible contributions to cellular interactions and tissue dynamics. The multifaceted nature of CD302/CLEC13A suggests its potential significance in orchestrating diverse cellular functions, prompting further investigation to elucidate the specific mechanisms and regulatory pathways through which it operates in different cellular contexts.

Verified Bioactivity

Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Human DEC-205/CD205 Protein(HY-P74203). The ED50 for this effect is 11.01 μg/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Human DEC-205/CD205 Protein (HY-P74203). The ED50 for this effect is 11.01 μg/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q5FVR3 (D21-H165)

  • Gene ID
    295629  [NCBI]
  • Molecular Construction
    • N-term
    • CD302 (D21-H165)
      Accession # Q5FVR3
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD302; Type I Transmembrane C-Type Lectin Receptor DCL-1; CD302 Molecule; C-Type Lectin Domain Family 13, Member A; CLEC13A; DEC205-Associated C-Type Lectin 1; CD302 Antigen; DCL1; KIAA0022; C-Type Lectin Domain Family 13 Member A; BIMLEC; C-Type Lectin B

  • AA Sequence

    DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

  • Molecular Weight

    Approximately 18 kDa & 22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Human DEC-205/CD205 Protein (HY-P74203). The ED50 for this effect is 11.01 μg/mL.

  • CD302/CLEC13A Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD302/CLEC13A Protein, Rat (HEK293, His)
  • CD302/CLEC13A Protein, Rat (HEK293, His) Product Image