1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Monocyte CD Proteins Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CD302/CLEC13A
  6. CD302/CLEC13A Protein, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Background

CD302/CLEC13A Protein emerges as a potential multifunctional C-type lectin receptor, suggesting its versatile involvement in various cellular processes. The protein exhibits potential roles in endocytosis and phagocytosis, indicating its participation in cellular clearance mechanisms. Moreover, CD302/CLEC13A is implicated in cell adhesion and migration, hinting at its possible contributions to cellular interactions and tissue dynamics. The multifaceted nature of CD302/CLEC13A suggests its potential significance in orchestrating diverse cellular functions, prompting further investigation to elucidate the specific mechanisms and regulatory pathways through which it operates in different cellular contexts.

Biological Activity

Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Human DEC-205/CD205 Protein(HY-P74203). The ED50 for this effect is 11.01 μg/mL.

  • Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Human DEC-205/CD205 Protein (HY-P74203). The ED50 for this effect is 11.01 μg/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q5FVR3 (D21-H165)

Gene ID
Molecular Construction
N-term
CD302 (D21-H165)
Accession # Q5FVR3
His
C-term
Protein Length

Extracellular Domain

Synonyms
CD302 antigen; C-type lectin domain family 13 member A; CD302; CLEC13A
AA Sequence

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

분자량

Approximately 18&22 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD302/CLEC13A Protein, Rat (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD302/CLEC13A Protein, Rat (HEK293, His)
Cat. No.:
HY-P76796
수량:
MCE Japan Authorized Agent: