CD31/PECAM-1 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD31/PECAM-1 protein, a pivotal cell adhesion molecule, is essential for leukocyte transendothelial migration (TEM) in most inflammatory conditions. The critical role of Tyr-679 in TEM is underscored by its requirement for efficient trafficking of PECAM1 to and from the lateral border recycling compartment (LBRC), crucial for targeting the LBRC membrane around migrating leukocytes. The trans-homophilic interaction potentially contributes to endothelial cell-cell adhesion via cell junctions, while heterophilic interaction with CD177 plays a role in the transendothelial migration of neutrophils. Homophilic ligation of PECAM1 serves a dual purpose, preventing macrophage-mediated phagocytosis of neighboring viable leukocytes by transmitting a detachment signal, while promoting the macrophage-mediated phagocytosis of apoptotic leukocytes by tethering them to phagocytic cells. Notably, PECAM1 modulates bradykinin receptor BDKRB2 activation and regulates bradykinin- and hyperosmotic shock-induced ERK1/2 activation in endothelial cells. Its interaction with various partners, including BDKRB2, GNAQ, PTPN11, FER, and CD177, further elucidates the intricate molecular mechanisms governing its diverse cellular functions, while its trans-homodimerization is crucial for effective cell-cell interaction. The interaction nuances, such as Ca(2+)-dependency and directness, add layers of complexity to the regulatory roles of CD31/PECAM-1.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Recombinant Mouse CD31/PECAM-1 binds to Recombinant Biotinylated Human Integrin alpha 8 beta 1 (HY-P73869) with an ED50 of 0.42 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Recombinant Mouse CD31/PECAM-1 binds to Recombinant Biotinylated Human Integrin alpha 8 beta 1 with an ED50 of 0.42 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD31 (E18-K590)
      Accession # Q08481
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    PECAM1; PECAM-1; Platelet And Endothelial Cell Adhesion Molecule 1; GPIIA'; Platelet Endothelial Cell Adhesion Molecule; PECA1; CD31 Antigen; Platelet/Endothelial Cell Adhesion Molecule 1; CD31; Platelet Endothelial Cell Adhesion Molecule-1; EndoCAM; CD31

  • AA Sequence

    EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

  • Molecular Weight

    Approximately 70-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 5 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00