CD39 Protein, Mouse (sf9, His)
The CD39 protein is expressed in the nervous system and regulates purinergic neurotransmission by hydrolyzing ATP and other nucleotides. It also prevents platelet aggregation by hydrolyzing platelet-activated ADP to AMP. CD39 Protein, Mouse (sf9, His) is the recombinant mouse-derived CD39 protein, expressed by sf9 insect cells , with C-His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The CD39 protein is expressed in the nervous system and regulates purinergic neurotransmission by hydrolyzing ATP and other nucleotides. It also prevents platelet aggregation by hydrolyzing platelet-activated ADP to AMP. CD39 Protein, Mouse (sf9, His) is the recombinant mouse-derived CD39 protein, expressed by sf9 insect cells , with C-His labeled tag.
CD39 protein, prominently expressed in the nervous system, plays a crucial role in the regulation of purinergic neurotransmission by hydrolyzing ATP and other nucleotides. Additionally, CD39 is implicated in preventing platelet aggregation through the hydrolysis of platelet-activating ADP to AMP. Notably, CD39 exhibits equal proficiency in hydrolyzing both ATP and ADP, underscoring its versatility in modulating purinergic signaling pathways and contributing to regulatory mechanisms that influence neurotransmission and platelet function. The dual enzymatic activity of CD39 highlights its significance in maintaining the delicate balance of purinergic signaling within the nervous system and the broader context of hemostasis.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P55772 (T38-I478)
-
Molecular Construction
-
N-term
-
CD39 (T38-I478)
Accession # P55772 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Ectonucleoside triphosphate diphosphohydrolase 1; NTPDase 1; Ecto-apyrase; CD39; Entpd1
-
AA Sequence
TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYI
-
Predicted Molecular Mass
51 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
