1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. CD39
  5. CD39 Protein, Mouse (sf9, His)

The CD39 protein is expressed in the nervous system and regulates purinergic neurotransmission by hydrolyzing ATP and other nucleotides. It also prevents platelet aggregation by hydrolyzing platelet-activated ADP to AMP. CD39 Protein, Mouse (sf9, His) is the recombinant mouse-derived CD39 protein, expressed by sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD39 protein is expressed in the nervous system and regulates purinergic neurotransmission by hydrolyzing ATP and other nucleotides. It also prevents platelet aggregation by hydrolyzing platelet-activated ADP to AMP. CD39 Protein, Mouse (sf9, His) is the recombinant mouse-derived CD39 protein, expressed by sf9 insect cells , with C-His labeled tag.

Background

CD39 protein, prominently expressed in the nervous system, plays a crucial role in the regulation of purinergic neurotransmission by hydrolyzing ATP and other nucleotides. Additionally, CD39 is implicated in preventing platelet aggregation through the hydrolysis of platelet-activating ADP to AMP. Notably, CD39 exhibits equal proficiency in hydrolyzing both ATP and ADP, underscoring its versatility in modulating purinergic signaling pathways and contributing to regulatory mechanisms that influence neurotransmission and platelet function. The dual enzymatic activity of CD39 highlights its significance in maintaining the delicate balance of purinergic signaling within the nervous system and the broader context of hemostasis.

Species

Mouse

Source

Sf9 insect cells

Tag

C-His

Accession

P55772 (T38-I478)

Gene ID
Molecular Construction
N-term
CD39 (T38-I478)
Accession # P55772
His
C-term
Protein Length

Extracellular Domain

Synonyms
Ectonucleoside triphosphate diphosphohydrolase 1; NTPDase 1; Ecto-apyrase; CD39; Entpd1
AA Sequence

TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYI

Predicted Molecular Mass
51 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD39 Protein, Mouse (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD39 Protein, Mouse (sf9, His)
Cat. No.:
HY-P72898
Quantity:
MCE Japan Authorized Agent: