CD42c/GP1BB Protein, Mouse (HEK293, Fc)
CD42c/GP1BB protein on platelets actively forms plugs by engaging with anchored von Willebrand factor. This involves disulfide-linked GP-Ib subunits, forming the GP-Ib heterodimer. GP-IX enhances receptor stability through a non-covalent linkage. Molecularly, CD42c's similarity to TRAF4 suggests a role in regulating the platelet function's regulatory network. CD42c/GP1BB Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD42c/GP1BB protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD42c/GP1BB protein on platelets actively forms plugs by engaging with anchored von Willebrand factor. This involves disulfide-linked GP-Ib subunits, forming the GP-Ib heterodimer. GP-IX enhances receptor stability through a non-covalent linkage. Molecularly, CD42c's similarity to TRAF4 suggests a role in regulating the platelet function's regulatory network. CD42c/GP1BB Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD42c/GP1BB protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD42c, a surface membrane protein found on platelets, actively contributes to the formation of platelet plugs by engaging with von Willebrand factor (vWF), which is already anchored to the subendothelium. This process involves the disulfide-linked association of two GP-Ib beta subunits with one GP-Ib alpha subunit, collectively forming the GP-Ib heterodimer. Additionally, GP-IX is intricately associated with the GP-Ib heterodimer through a non-covalent linkage, enhancing the overall stability and functionality of this platelet surface receptor. In molecular interactions, CD42c exhibits a similarity to its association with tumor necrosis factor receptor-associated factor 4 (TRAF4), suggesting a role in the regulatory network governing platelet function.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P56400 (P27-C147)
-
Molecular Construction
-
N-term
-
Gp1bb (P27-C147)
Accession # P56400 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GP1BB; Truncated Platelet Membrane Glycoprotein Ib Beta; Glycoprotein Ib Platelet Subunit Beta; Platelet Membrane Glycoprotein Ib Beta; Platelet Glycoprotein Ib Beta Chain; Glycoprotein Ib Platelet Beta Subunit; Antigen CD42b-Beta; CD42c Antigen; GPIbbeta
-
AA Sequence
PAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLC
-
Predicted Molecular Mass
39.5 kDa
-
Molecular Weight
Approximately 46-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
