1. Recombinant Proteins
  2. CD Antigens
  3. Platelet CD Proteins
  4. CD42c/GP-Ib beta
  5. CD42c/GP1BB Protein, Mouse (HEK293, Fc)

CD42c/GP1BB protein on platelets actively forms plugs by engaging with anchored von Willebrand factor. This involves disulfide-linked GP-Ib subunits, forming the GP-Ib heterodimer. GP-IX enhances receptor stability through a non-covalent linkage. Molecularly, CD42c's similarity to TRAF4 suggests a role in regulating the platelet function's regulatory network. CD42c/GP1BB Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD42c/GP1BB protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD42c/GP1BB protein on platelets actively forms plugs by engaging with anchored von Willebrand factor. This involves disulfide-linked GP-Ib subunits, forming the GP-Ib heterodimer. GP-IX enhances receptor stability through a non-covalent linkage. Molecularly, CD42c's similarity to TRAF4 suggests a role in regulating the platelet function's regulatory network. CD42c/GP1BB Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD42c/GP1BB protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD42c, a surface membrane protein found on platelets, actively contributes to the formation of platelet plugs by engaging with von Willebrand factor (vWF), which is already anchored to the subendothelium. This process involves the disulfide-linked association of two GP-Ib beta subunits with one GP-Ib alpha subunit, collectively forming the GP-Ib heterodimer. Additionally, GP-IX is intricately associated with the GP-Ib heterodimer through a non-covalent linkage, enhancing the overall stability and functionality of this platelet surface receptor. In molecular interactions, CD42c exhibits a similarity to its association with tumor necrosis factor receptor-associated factor 4 (TRAF4), suggesting a role in the regulatory network governing platelet function.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P56400 (P27-C147)

Gene ID
Molecular Construction
N-term
Gp1bb (P27-C147)
Accession # P56400
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
GP-Ib beta; GPIb-beta; GPIbB; Gp1bb; BDPLT1; BS; CD42c; GP1BB; GPIbb; GPIbbeta
AA Sequence

PAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLC

Predicted Molecular Mass
39.5 kDa
Molecular Weight

Approximately 46-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD42c/GP1BB Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD42c/GP1BB Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD42c/GP1BB Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77686
Quantity:
MCE Japan Authorized Agent: