CD43 Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The CD43 protein in mice emerges as the predominant cell surface sialoprotein of leukocytes, wielding a regulatory influence over various T-cell functions crucial to immune responses. CD43 positively regulates T-cell activation, proliferation, differentiation, trafficking, and migration, particularly enhancing T-cell trafficking to lymph nodes through its interaction with ERM proteins (EZR, RDX, and MSN). In addition to negatively regulating Th2 cell differentiation, CD43 steers T-cells towards a Th1 lineage commitment. It plays a pivotal role in inducing the expression of IFN-gamma during T-cell receptor (TCR) activation, affecting both CD4(+) and CD8(+) T-cells, and contributes to T-cell preparation for cytokine sensing and differentiation into effector cells by influencing the expression of cytokine receptors IFNGR and IL4R. Serving as a major E-selectin ligand, CD43 facilitates Th17 cell rolling on activated vasculature and subsequent recruitment during inflammation, mediating Th17 cell adhesion to E-selectin. Moreover, CD43 acts as a T-cell counter-receptor for SIGLEC1 and exhibits a protective role by shielding cells from apoptotic signals, thus promoting cell survival.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P15702 (D20-G248)
-
Molecular Construction
-
N-term
-
CD43 (D20-G248)
Accession # P15702 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SPN; LSN; Sialophorin; Sialophorin (GpL115, Leukosialin, CD43); GPL115; Leukocyte Sialoglycoprotein; CD43; Galactoglycoprotein; Leukosialin; GALGP; LEU-22; CD43 Antigen
-
AA Sequence
DSLQRTTMLPSTPHITAPSTSEAQNASPSVSVGSGTVDSKETISPWGQTTIPVSLTPLETTELSSLETSAGASMSTPVPEPTASQEVSSKTSALLPEPSNVASDPPVTAANPVTDGPAANPVTDGTAASTSISKGTSAPPTTVTTSSNETSGPSVATTVSSKTSGPPVTTATGSLGPSSEMHGLPATTATSSVESSSVARGTSVSSRKTSTTSTQDPITTRSPSQESSG
-
Predicted Molecular Mass
49.6 kDa
-
Molecular Weight
Approximately 75-120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)