CD43 Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CD43 protein in mice emerges as the predominant cell surface sialoprotein of leukocytes, wielding a regulatory influence over various T-cell functions crucial to immune responses. CD43 positively regulates T-cell activation, proliferation, differentiation, trafficking, and migration, particularly enhancing T-cell trafficking to lymph nodes through its interaction with ERM proteins (EZR, RDX, and MSN). In addition to negatively regulating Th2 cell differentiation, CD43 steers T-cells towards a Th1 lineage commitment. It plays a pivotal role in inducing the expression of IFN-gamma during T-cell receptor (TCR) activation, affecting both CD4(+) and CD8(+) T-cells, and contributes to T-cell preparation for cytokine sensing and differentiation into effector cells by influencing the expression of cytokine receptors IFNGR and IL4R. Serving as a major E-selectin ligand, CD43 facilitates Th17 cell rolling on activated vasculature and subsequent recruitment during inflammation, mediating Th17 cell adhesion to E-selectin. Moreover, CD43 acts as a T-cell counter-receptor for SIGLEC1 and exhibits a protective role by shielding cells from apoptotic signals, thus promoting cell survival.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD43 (D20-G248)
      Accession # P15702
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SPN; LSN; Sialophorin; Sialophorin (GpL115, Leukosialin, CD43); GPL115; Leukocyte Sialoglycoprotein; CD43; Galactoglycoprotein; Leukosialin; GALGP; LEU-22; CD43 Antigen

  • AA Sequence

    DSLQRTTMLPSTPHITAPSTSEAQNASPSVSVGSGTVDSKETISPWGQTTIPVSLTPLETTELSSLETSAGASMSTPVPEPTASQEVSSKTSALLPEPSNVASDPPVTAANPVTDGPAANPVTDGTAASTSISKGTSAPPTTVTTSSNETSGPSVATTVSSKTSGPPVTTATGSLGPSSEMHGLPATTATSSVESSSVARGTSVSSRKTSTTSTQDPITTRSPSQESSG

  • Predicted Molecular Mass

    49.6 kDa

  • Molecular Weight

    Approximately 75-120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00