CD43 Protein, Mouse (HEK293, Fc)

CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function. It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins. CD43 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD43 Protein, Mouse (HEK293, Fc) is 229 a.a., with molecular weight of 72-120 kDa.

The CD43 protein in mice emerges as the predominant cell surface sialoprotein of leukocytes, wielding a regulatory influence over various T-cell functions crucial to immune responses. CD43 positively regulates T-cell activation, proliferation, differentiation, trafficking, and migration, particularly enhancing T-cell trafficking to lymph nodes through its interaction with ERM proteins (EZR, RDX, and MSN). In addition to negatively regulating Th2 cell differentiation, CD43 steers T-cells towards a Th1 lineage commitment. It plays a pivotal role in inducing the expression of IFN-gamma during T-cell receptor (TCR) activation, affecting both CD4(+) and CD8(+) T-cells, and contributes to T-cell preparation for cytokine sensing and differentiation into effector cells by influencing the expression of cytokine receptors IFNGR and IL4R. Serving as a major E-selectin ligand, CD43 facilitates Th17 cell rolling on activated vasculature and subsequent recruitment during inflammation, mediating Th17 cell adhesion to E-selectin. Moreover, CD43 acts as a T-cell counter-receptor for SIGLEC1 and exhibits a protective role by shielding cells from apoptotic signals, thus promoting cell survival.

Mouse

HEK293

C-hFc

P15702 (D20-G248)

20737  [NCBI]

DSLQRTTMLPSTPHITAPSTSEAQNASPSVSVGSGTVDSKETISPWGQTTIPVSLTPLETTELSSLETSAGASMSTPVPEPTASQEVSSKTSALLPEPSNVASDPPVTAANPVTDGPAANPVTDGTAASTSISKGTSAPPTTVTTSSNETSGPSVATTVSSKTSGPPVTTATGSLGPSSEMHGLPATTATSSVESSSVARGTSVSSRKTSTTSTQDPITTRSPSQESSG

72-120 kDa

Greater than 90% as determined by Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.