CD5 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Based on 1 Customer Validation
The CD5 protein is a potential receptor that regulates T cell proliferation. Its interactions with CD72/LYB-2 and PTPN6/SHP-1 indicate multifaceted roles in cellular processes, serving as key mediators of T cell responses. CD5 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived CD5 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD5 protein is a potential receptor that regulates T cell proliferation. Its interactions with CD72/LYB-2 and PTPN6/SHP-1 indicate multifaceted roles in cellular processes, serving as key mediators of T cell responses. CD5 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived CD5 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
Background
The CD5 Protein presents itself as a potential receptor implicated in the regulation of T-cell proliferation. Its interaction with CD72/LYB-2 and PTPN6/SHP-1 suggests a multifaceted role in modulating cellular processes. Acting as a receptor, this protein may play a pivotal part in orchestrating T-cell responses, mediating crucial interactions with other cellular components. The engagement with CD72/LYB-2 and PTPN6/SHP-1 underscores its involvement in intricate signaling pathways, hinting at its significance in the regulatory networks that govern T-cell behavior. Further exploration of the CD5 Protein's functions could provide valuable insights into the molecular mechanisms underlying T-cell proliferation and immune modulation.
Verified Bioactivity
Immobilized Anti-CD5 Antibody at 2 ug/ml (100μL/Well) on the plate. Dose response curve for Biotinylated Human CD5, hFc Tag with the EC50 of 17.7 ng/ml determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-hFc
-
Accession
P06127 (R25-N371)
-
Molecular Construction
-
N-term
-
CD5 (R25-N371)
Accession # P06127 -
hFc-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CD5; Lymphocyte Antigen T1/Leu-1; Prev. LEU1; Epididymis Secretory Sperm Binding Protein; T-Cell Surface Glycoprotein CD5; CD5 Antigen; T1; CD5 Molecule; CD5 Antigen (P56-62)
-
AA Sequence
RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPN
-
Predicted Molecular Mass
67.1 kDa
-
Molecular Weight
Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)