CD70 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells. As for CD70 protein in cynomolgus contains TNF_2 domain (57-189 a.a) and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 Protein, Cynomolgus (HEK293, His) is 156 amino acids in length (Q39-P194) and is expressed in the HEK293 cells with a N terminal His-tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity[1]. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells[2][3]. As for CD70 protein in cynomolgus contains TNF_2 domain (57-189 a.a) and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 Protein, Cynomolgus (HEK293, His) is 156 amino acids in length (Q39-P194) and is expressed in the HEK293 cells with a N terminal His-tag.

Background

CD70 (CD27 Ligand) belongs to the tumor necrosis factor (TNF) family, is the ligand for TNFRSF27/CD27[1].
CD70 and CD27 are homotrimer type II and homodimer type I transmembrane glycoprotein, expressing on activated and resting T and B lymphocytes, respectively[3][4].  CD70 as one of the most frequently mutated genes in a series of diffuse large B cell lymphomas, especially acts in a crucial Epstein-Barr virus (EBV)-specific T cell immunity and more generally for the immune surveillance of B cells. CD70 inhibits EBV infection by restoring the expansion of EBV-specific T lymphocytes stimulated by the CD70-deficient EBV-infected B cells[3].
CD70 involves in activation of innate and adaptive immunity, expressing in the mature dendritic cells and being up-regulated upon the triggering of CD40 or Toll-like receptors[2].
CD70 induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation[4].
CD70 is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis[5]. targeting CD70 positive tumors with CAR-T cells induces a potent antitumor response[6].

Verified Bioactivity

Immobilized Cynomolgus CD27 Ligand at 2 μg/mL (100μL/Well) on the plate. Dose response curve for Cynomolgus/Rhesus macaque CD27 with the EC50 of 60.8 ng/mL determined by ELISA.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • CD70 (Q39-P194)
      Accession # G7PYU6-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD70; Tumor Necrosis Factor Ligand Superfamily Member 7; Prev. CD27LG; Tumor Necrosis Factor Ligand 8A; Prev. TNFSF7; Surface Antigen CD70; CD70 Antigen; Ki-24 Antigen; CD27 Ligand; TNLG8A; CD27-L; LPFS3; CD27L; CD70 Molecule; Tumor Necrosis Factor (Ligan

  • AA Sequence

    QRLSRAQQQLPLESLGWDIAELQLNHTGPQQDPRLYWQGGPALGRSFLRGPELDKGQLRIRRDGIYMVHIQVTLAICSSTSTSRHHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

  • Predicted Molecular Mass

    18.4 kDa

  • Molecular Weight

    Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00