CD79B Protein, Human (HEK293, His-Avi)
CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
CD79B Protein plays an essential role in conjunction with CD79A in initiating the signal transduction cascade triggered by the B-cell antigen receptor complex (BCR). This pivotal function leads to the internalization of the complex, subsequent trafficking to late endosomes, and eventual antigen presentation. CD79B enhances the phosphorylation of CD79A, potentially by recruiting kinases that phosphorylate CD79A or by engaging proteins that bind to CD79A, safeguarding it from dephosphorylation. Forming a heterodimer with the alpha chain, CD79B forms a disulfide-linked complex. It is an integral component of the B-cell antigen receptor complex, where the alpha/beta chain heterodimer associates non-covalently with an antigen-specific membrane-bound surface immunoglobulin comprising two heavy chains and two light chains. Additionally, CD79B interacts with LYN, further contributing to its regulatory role in B-cell signaling.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P40259 (A29-D159)
-
Molecular Construction
-
N-term
-
CD79B (A29-D159)
Accession # P40259 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD79B; CD79b Molecule, Immunoglobulin-Associated Beta; Prev. IGB; B-Cell-Specific Glycoprotein B29; Ig-Beta; B-Cell Antigen Receptor Complex-Associated Protein Beta Chain Isoform 3; B29; CD79b Antigen; B-Cell Antigen Receptor Complex-Associated Protein Be
-
AA Sequence
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
-
Predicted Molecular Mass
18.1 kDa
-
Molecular Weight
Approximately 33-42 kDa, based on SDS-PAGE under reducing conditions,due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)