CD79B Protein, Human (HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

CD79B Protein plays an essential role in conjunction with CD79A in initiating the signal transduction cascade triggered by the B-cell antigen receptor complex (BCR). This pivotal function leads to the internalization of the complex, subsequent trafficking to late endosomes, and eventual antigen presentation. CD79B enhances the phosphorylation of CD79A, potentially by recruiting kinases that phosphorylate CD79A or by engaging proteins that bind to CD79A, safeguarding it from dephosphorylation. Forming a heterodimer with the alpha chain, CD79B forms a disulfide-linked complex. It is an integral component of the B-cell antigen receptor complex, where the alpha/beta chain heterodimer associates non-covalently with an antigen-specific membrane-bound surface immunoglobulin comprising two heavy chains and two light chains. Additionally, CD79B interacts with LYN, further contributing to its regulatory role in B-cell signaling.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD79B (A29-D159)
      Accession # P40259
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD79B; CD79b Molecule, Immunoglobulin-Associated Beta; Prev. IGB; B-Cell-Specific Glycoprotein B29; Ig-Beta; B-Cell Antigen Receptor Complex-Associated Protein Beta Chain Isoform 3; B29; CD79b Antigen; B-Cell Antigen Receptor Complex-Associated Protein Be

  • AA Sequence

    ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

  • Predicted Molecular Mass

    18.1 kDa

  • Molecular Weight

    Approximately 33-42 kDa, based on SDS-PAGE under reducing conditions,due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00